Name : UNC5C Antibody
Supplier : NJS POLY
Price :406
SKU : GEN3606664423
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | UNC5C |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 1-0, 5ug/ml, Western blot: 0 |
| Notes | Optimal dilution of the UNC5C antibody should be determined by the researcher |
| Intented use | This UNC5C antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | O95185 |
| Purity | Antigen affinity |
| Description | Netrins are secreted proteins that direct axon extension and cell migration during neural development, The UNC-5 family of receptors mediates the repellent response to netrin, They are bifunctional proteins that act as attractants for some cell types and as repellents for others, This gene product belongs to the UNC-5 family of netrin receptors, and these opposite actions are thought to be mediated by two classes of receptors, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region, Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene |
| Immunogen | Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UNC5C antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | UNC5C |
| Short name | UNC5C Antibody |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | elegans) (Antibody to), unc-5 homolog C (C |
| Alternative technique | antibodies |
| Alternative to gene target | Plasma membranes, UNC5C and IDBG-30714 and ENSG00000182168 and 8633, UNC5C and IDBG-640984 and ENSBTAG00000002084 and 533256, UNC5H3, Unc5c and IDBG-196891 and ENSMUSG00000059921 and 22253, elegans), protein binding, this GO :0005042 and netrin receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007411 and axon guidance and biological process this GO :0007420 and brain development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030334 and regulation of cell migration and biological process this GO :0033564 and anterior/posterior axon guidance and biological process this GO :0038007 and netrin-activated signaling pathway and biological process this GO :0043065 and positive regulation of apoptotic process and biological process, this GO :0005042: netrin receptor activity, this GO :0005042: netrin receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, unc-5 homolog C (C |
| Identity | 12569 |
| Gene | UNC5C |
| Long gene name | unc-5 netrin receptor C |
| Synonyms gene name | elegans) , unc5 (C, elegans homolog) c unc-5 homolog C (C |
| Locus | 4q22, 3 |
| Discovery year | 1998-12-09 |
| GenBank acession | AF055634 |
| Entrez gene record | 8633 |
| Pubmed identfication | 9126742 9782087 12655055 |
| RefSeq identity | NM_003728 |
| Classification | I-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000130989 |