Filters

UPF3B / RENT3B Antibody

UPF3B / RENT3B Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenUPF3B / RENT3B
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the UPF3B antibody should be determined by the researcher
Intented useThis UPF3B antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9BZI7
PurityAntigen affinity
Description It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions, The encoded protein is one of two functional homologs to yeast Upf3p, This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance, This gene is located on the long arm of chromosome X, This protein binds to the mRNA and remains bound after nuclear export, Two splice variants encoding different isoforms have been found for this gene, When translation ends upstream from the last exon-exon junction, acting as a nucleocytoplasmic shuttling protein, mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD), this triggers NMD to degrade mRNAs containing premature stop codons, Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene
ImmunogenAmino acids SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL of human UPF3B were used as the immunogen for the UPF3B antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UPF3B antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetUPF3B / RENT3B
Short nameUPF3B / RENT3B Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameUPF3B / RENT3B (Antibody to)
Alternative techniqueantibodies
Identity 20439
Gene UPF3B
Long gene name UPF3 regulator of nonsense transcripts homolog B (yeast)
Synonyms gene MRX62 UPF3BP1 UPF3BP2 UPF3BP3
Synonyms gene name X-linked 62 UPF3B pseudogene 1 UPF3B pseudogene 2 UPF3B pseudogene 3 , mental retardation
Synonyms RENT3B UPF3X HUPF3B
Locus Xq24
Discovery year 2003-02-07
GenBank acession AF318576
Entrez gene record 65109
Pubmed identfication 11113196 11163187 19238151
RefSeq identity NM_080632
Classification X-linked mental retardation
Havana BLAST/BLAT OTTHUMG00000022282
Locus Specific Databases Mental Retardation database

Similar products

Subscribe to our Newsletter