Product Listing

GEN3879586685 MMP Biotinylated Substrate I (AA: Biotin-LC-Pro-Leu-Gly-Leu-Arg-Ala-Tyr-NH2) (MW: 1127.43) ADI 5 mg 333 €

GEN7955154746 Exendin 4 (3-39) (AA: Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2) (MW: 3991.5) ADI 1 mg 333 €

GEN9270218791 MMP Substrate I, fluorogenic (AA: Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2) (MW: 977.1) ADI 1 mg 188 €

GEN7162529971 HIV-1, HIV-2 Protease Substrate (AA:Ala-Thr-Leu-Asn-Phe-Pro-Ile-Ser-Pro-Trp) (MW: 1145.3) ADI 5 mg 333 €

GEN1494792555 gp120, HIV-1 MN (AA: Tyr-Asn-Ala-Lys-Arg-Lys-Arg-Ile-His-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Tyr-Thr-Thr-Lys-Asn-Ile-Ile) (MW: 3002.55) ADI 1 mg 260 €

GEN7491771116 Gastrin Releasing Peptide-Lys(Biotin), human (AA:Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-Lys(Biotin)) (MW: 2859.3) ADI 1 mg 333 €

GEN7870518758 Galanin Message Associated Peptide (1-41), amide; GMAP (1-41), amide; Preprogalanin (65-105), amide ADI 1 mg 478 €

GEN1784275313 Galanin (1-13)-Spantide I (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2) (MW: 2828.34) ADI 1 mg 333 €

GEN3432438630 Galanin (1-13)-Neuropeptide Y (25-36), amide (M32) (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2) (MW: 2962.4) ADI 1 mg 260 €

GEN5865054475 Galanin-Lys(Biotin), human (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin)) (MW: 3511.95) ADI 1 mg 333 €

GEN5809582838 G-R-G-E-T-P (AA: Gly-Arg-Gly-Glu-Thr-Pro) (MW: 615.7) ADI 5 mg 188 €

GEN1677415541 Myelopeptide-2 (MP-2) (AA: Leu-Val-Val-Tyr-Pro-Trp) (MW: 776) ADI 5 mg 188 €

GEN3506245152 [D-Tyr6, ï¢-Ala11, β-Phe13, Nle14]-Bombesin [Pyr-Gln-Arg-Leu-Gly-D-Tyr-Gln-Trp-Ala-Val-Beta-Ala-His-β-Phe-Nle-NH2; MW: 1698.98] ADI 1 mg 260 €

GEN2629154040 S-I-G-S-L-A-K (AA: Ser-Ile-Gly-Ser-Leu-Ala-Lys) (MW: 674.8) ADI 5 mg 188 €

GEN1697033145 Magainin Spacer Peptide (AA: Asp-Ala-Glu-Ala-Val-Gly-Pro-Glu-Ala-Phe-Ala-Asp-Gln-Asp-Leu-Asp-Glu-Arg-Glu-Val-Arg) (MW: 2332.3) ADI 1 mg 188 €

GEN8278119933 [D-Ser14] - Humanin (HN) [Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-D-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-arg-Arg-Ala; MW: 2687.28] ADI 1 mg 260 €

GEN2813156359 Allatotropin, Mas – AT (AA:Gly-Phe-Lys-Asn-Val-Glu-Met-Met-Thr-Ala-Arg-Gly-Phe-NH2 (Disulfide bridge:Cys2-Cys7) (MW: 1486.8) ADI 1 mg 188 €

GEN9745943278 Allatostatin VII (AA: Asp-Gly-Arg-Met-Tyr-Ser-Phe-Gly-Leu-NH2) (MW: 1044.2) ADI 5 mg 333 €

GEN8909874645 Allatostatin VI (AA: Tyr-Pro-Gln-Glu-His-Arg-Phe-Ser-Phe-Gly-Leu-NH2) (MW: 1379.5) ADI 5 mg 333 €

GEN7194392274 Allatostatin I (free acid) (AA: Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu) (MW: 1335.5) ADI 5 mg 333 €

GEN8383960310 Human AGRP (87-132), human (AA: Ac-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr) (MW: 5243.17) ADI 1 mg 478 €

GEN5536572439 Human AGRP (54-82) (AA: Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg) (MW: 3282.5) ADI 1 mg 333 €

GEN2086267465 Human AGRP (25-51) (AA: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu) (MW: 2894.5) ADI 1 mg 260 €

GEN7077703302 Pro-Adrenomedullin N20, rat (AA:Ala-Arg-Leu-Asp-Thr-Ser-Ser-Gln-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2477.9) ADI 1 mg 188 €

GEN2161313028 Pro-Adrenomedullin N20, human (AA: Ala-Arg-Leu-Asp-Val-Ala-Ala-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2444.9) ADI 1 mg 188 €

GEN2802546224 Prepro-adrenomedullin (153 - 185), human (AA: Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu) (MW: 3219.6) ADI 1 mg 260 €

GEN9679071557 Adrenomedullin (1- 52), porcine [(AA: see antigen, sequence too long) (MW: 5971.8)] ADI 1 mg 623 €

GEN3339571783 Adrenomedullin (1-12), human (AA: Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg) (MW: 1513.7) ADI 5 mg 333 €

GEN5126117055 Myristoylated ADP - Ribosylation Factor 6, myr - ARF6 (2 - 13) (AA: Myristoyl -Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu) (MW: 1529.95) ADI 5 mg 333 €

GEN2617563132 Myristoylated ADP - Ribosylation Factor 1, myr - ARF1 (2 - 17) (AA: Myristoyl -Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu) (MW: 1993.49) ADI 1 mg 188 €

GEN9030871417 ADP-Ribosylation Factor 1, ARF1 (2 - 17) (AA: Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu) (MW: 1783.12) ADI 1 mg 188 €

GEN7287103561 Biotin-ACTH (1-39), human (AA: Biotin-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe) (MW: 4767.47) ADI 1 mg 623 €

GEN8568122370 [Glu10] - ACTH (1 - 17) [Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Glu-Lys-Pro-Val-Gly-Lys-Lys-Arg; MW: 2165.50] ADI 5 mg 478 €

GEN1992938455 Fibrinopeptide B, Bovine (AA: Gln-Phe-Pro-Thr-Asp-Tyr-Asp-Glu-Gly-Gln-Asp-Asp-Arg-Pro-Lys-Val-Gly-Leu-Gly-Ala-Arg) (MW: 2364.53) ADI 1 mg 188 €

GEN1859694168 [Phe1376] - Fibronectin Fragment (1371 - 1382) [Arg-Gln-Asp-Arg-Val-Phe-His-Ser-Arg-Asn-Ser-Ile; MW 1514.68] ADI 1 mg 333 €

GEN5258781212 FDC - SP (61 - 85), human (AA: Phe-Pro-Trp-Phe-Arg-Arg-Asn-Phe-Pro-Ile-Pro-Ile-Pro-Glu-Ser-Ala-Pro-Thr-Thr-Pro-Leu-Pro-Ser-Glu-Lys) (MW: 2925.41) ADI 1 mg 260 €

GEN6376454894 FDC - SP (30 - 85), human ADI 1 mg 623 €

GEN8412629667 Biotin-Exendin 4 ADI 0,5 mg 478 €

GEN6492352408 proPT28 (AA: His-Val-Phe-Leu-Ala-Pro-Gln-Gln-Ala-Arg-Ser-Leu-Leu-Gln-Arg-Val-Arg-Arg-Ala-Asn-Thr-Phe-Leu-Glu-Glu-Val-Arg-Lys) (MW: 3363.95) ADI 1 mg 260 €

GEN1526143507 proPT18 (AA: His-Val-Phe-Leu-Ala-Pro-Gln-Gln-Ala-Arg-Ser-Leu-Leu-Gln-Arg-Val-Arg-Arg) (MW: 2175.59) ADI 1 mg 188 €

GEN6053407005 proFIX28 (AA: Thr-Val-Phe-Leu-Asp-His-Glu-Asn-Ala-Asn-Lys-Ile-Leu-Asn-Arg-Pro-Lys-Arg-Tyr-Asn-Ser-Gly-Lys-Leu-Glu-Glu-Phe-Val) (MW: 3332.80) ADI 1 mg 260 €

GEN4841305209 proFIX18 (AA: Thr-Val-Phe-Leu-Asp-His-Glu-Asn-Ala-Asn-Lys-Ile-Leu-Asn-Arg-Pro-Lys-Arg) (MW: 2165.50) ADI 1 mg 188 €

GEN5853057414 pro - ε - Tx1X/12 (AA: Leu-Lys-Arg-Thr-Ile-Arg-Thr-Arg-Leu-Asn-Ile-Arg) (MW: 1539.90) ADI 5 mg 333 €

GEN5821935574 HJ Inhibitor Peptide 2 (AA: Lys-Trp-Trp-Cys-Arg-Trp) (MW: 964.16) ADI 5 mg 188 €

GEN1910690275 Dok-6 (263 - 275) (AA: Leu-Pro-Arg-Ser-Ala-Tyr-Trp-His-His-Ile-Thr-Arg-Gln) (MW: 1664.90) ADI 5 mg 333 €

GEN2999300215 Dok- 5 (263 - 275) (AA: Leu-Pro-Arg-Ser-Ala-Tyr-Trp-Gln-His-Ile-Thr-Arg-Gln) (MW: 1655.89) ADI 5 mg 333 €

GEN1196778680 Dok-4 (263 - 275) (AA: Leu-Pro-Arg-Ser-Ala-Tyr-Trp-His-His-Ile-Thr-Gly-Ser) (MW: 1524.72) ADI 5 mg 333 €

GEN4294336899 Dok-4 (130 - 145) (AA: Gly-Val-Gln-Cys-Glu-Gln-Thr-Asp-Arg-Phe-Asn-Val-Phe-Leu-Leu-Pro) (MW: 1866.1) ADI 1 mg 188 €

GEN9569516911 Cathepsin S substrate (AA: Ac-Lys-Gln-Lys-Leu-Arg-AMC) (MW: 871.08) ADI 2mg 231 €

GEN8623898994 Cathepsin G (77 - 83) (AA: His-Pro-Gln-Tyr-Asn-Gln-Arg) (MW: 942.01) ADI 5 mg 188 €

GEN7948366194 3/4A, Dengue Protease Substrate [Ac-Phe-Ala-Ala-Gly-Arg-Lys- pNA; MW: 810.9] ADI 1 mg 188 €

GEN3999546979 2B/3, Dengue Protease Substrate [Ac-Glu-Val-Lys-Lys-Gln-Arg- pNA; MW: 949.09] ADI 1 mg 188 €

GEN2438579010 2A/2B Dengue Protease Substrate [Ac-Arg-Thr-Ser-Lys-Lys-Arg- pNA; MW: 937.08] ADI 1 mg 188 €

GEN4368983637 ε- TxIX12 [Glu-Cys-Cys-Glu-Asp-Gly-Trp-Cys-Cys-Thr-Ala-Ala (MW: 2812.3)] ADI 5 mg 333 €

GEN1962020739 MKKp2 (AA: Ser-Lys-Gly-Lys-Ser-Lys-Arg-Lys-Lys-Asp-Leu-Arg-Ile-Ser-Cys-Asn-Ser-Lys) (MW: 2063.5) ADI 1 mg 188 €

GEN4617984006 Leucokinin VII (AA: Asp-Pro-Ala-Phe-Ser-Ser-Trp-Gly-NH2) (MW: 864.9) ADI 5 mg 260 €

GEN3490017464 Leucokinin V (AA: Gly-Ser-Gly-Phe-Ser-Ser-Trp-Gly-NH2) (MW: 782.8) ADI 5 mg 260 €

GEN6580235487 Leucokinin IV (AA: Asp-Ala-Ser-Phe-His-Ser-Trp-Gly-NH2) (MW: 904.9) ADI 5 mg 260 €

GEN6839925718 Leucokinin III (AA: Asp-Gln-Gly-Phe-Asn-Ser-Trp-Gly-NH2) (MW: 908.9) ADI 5 mg 260 €

GEN9065660836 Leucokinin II (AA: Asp-Pro-Gly-Phe-Ser-Ser-Trp-Gly-NH2) (MW: 850.9) ADI 5 mg 260 €

GEN2151706478 Laminin A Chain (2091-2108) (AA: Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg) (MW: 2016.3) ADI 5 mg 188 €

GEN2588147891 SALMF amide 2 (S2) (AA: Ser-Gly-Pro-Tyr-Ser-Phe-Asn-Ser-Gly-Leu-Thr-Phe-NH2) (MW: 1275.4 ADI 5 mg 333 €

GEN1336561467 SALMF amide 1 (S1) (AA: Gly-Phe-Asn-Ser-Ala-Leu-Met-Phe-NH2) (MW: 885.1) ADI 5 mg 260 €

GEN7858791005 Locustachykinin II (AA: Ala-Pro-Leu-Ser-Gly-Phe-Tyr-Gly-Val-Arg-NH2) (MW: 1065.4) ADI 5 mg 333 €

GEN6411824338 Locustachykinin I (AA: Gly-Pro-Ser-Gly-Phe-Tyr-Gly-Val-Arg-NH2) (MW: 938) ADI 5 mg 333 €

GEN2697276530 [Tyr0]-Prepro-Atrial Natriuretic Factor (104-123) (human) [Tyr-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr-Ala-Pro-Arg; MW 2346.8] ADI 1 mg 188 €

GEN3350720704 Prepro-Atrial Natriuretic Factor (104-123) (human) (AA: Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr-Ala-Pro-Arg) (MW: 2183.6) ADI 1 mg 188 €

GEN8800152687 Prepro-Atrial Natriuretic Factor (56-92) (human) (AA: Glu-Val-Val-Pro-Pro-Gln-Val-Leu-Ser-Glu-Pro-Asn-Glu-Glu-Ala-Gly-Ala-Ala-Leu-Ser-Pro-Leu-Pro-Glu-Val-Pro-Pro-Trp-Thr-Gly-Glu-Val-Ser-Pro-Ala-Gln-Arg) (MW: 3878.3) ADI 1 mg 405 €

GEN4785358385 Prepro-Atrial Natriuretic Factor (26-55) (human) (AA: Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp) (MW: 3508) ADI 1 mg 333 €

GEN8140134430 mini-ANP (AA:Met-Cys-His-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Ser-Cys-Tyr-Arg-NH2 (Disulfide bridge:Cys2-Cys13)) (MW: 1829.19) ADI 1 mg 188 €

GEN1441693468 [Tyr0]-Atriopeptin II (rat) [Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg (Disulfide bridge:Cys4-Cys20 ); MW 2549.9] ADI 1 mg 260 €

GEN3362599869 Big Endothelin -1 (1-39), porcine (AA: Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser (Disulfide bridge: Cys1-Cys15, Cys3-Cys11)) ADI 1 mg 623 €

GEN7007136921 Ac-β- Endorphin, bovine, camel, ovine [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln (MW: 3480.1)] ADI 1 mg 260 €

GEN2444613095 Atrial Natriuretic Factor (4-28) (human) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23 )) (MW: 2724.06) ADI 0,5 mg 333 €

GEN5909490744 [Cys18]-Atrial Natriuretic Factor (4-18) amide (rat)[Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Cys-NH2; (Disulfide bridge:Cys7-Cys18); MW: 1594.9] ADI 5 mg 333 €

GEN5742731542 Atrial Natriuretic Factor (3-28) (human) (AA: Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys5-Cys21 )) (MW: 2880.3) ADI 0,5 mg 333 €

GEN7781051701 Atrial Natriuretic Factor (1-29) (chicken) (AA: Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Ile-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Met-Gly-Cys-Asn-Gly-Ser-Arg-Lys-Asn (Disulfide bridge Cys7-Cys23 )) (MW: 3160.7) ADI 0,5 mg 333 €

GEN1506492899 Biotin-β-Endomorphin, human (AA: Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu) (MW: 3691.36) ADI 1 mg 333 €

GEN9642881924 Atrial Natriuretic Factor (1-24) (frog) (AA: Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe (MW: 2561.87) (Disulfide bridge:Cys4-Cys20) (MW: 2561.87) ADI 0,5 mg 333 €

GEN5382791991 Aldosterone Secretion Inhibiting Factor (1-35) (bovine) (AA: Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge:Cys13-Cys29) (MW: 3910.64) ADI 1 mg 623 €

GEN2308828147 Dynorphin A (2 - 13), porcine (AA: Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys) (MW: 1440.81) ADI 5 mg 333 €

GEN9426113041 Biotin-Dynorphin A (1-17) (AA: Biotin-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln) (MW: 2373.83) ADI 1 mg 188 €

GEN4060865924 [D-Arg8] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys; MW: 1647.01] ADI 5 mg 333 €

GEN2119452516 [D-Arg6] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-D-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MW: 1603.98] ADI 5 mg 333 €

GEN7283264883 Defensin-1 (human) HNP-1 (AA: Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridges Cys2-Cys30, Cys4-Cys19, and Cys 9-29 )) (MW: 3442.1) ADI 1 mg 623 €

GEN4615857357 β-Defensin-3, human (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41) (MW: 5155.22) ADI 1 mg 1428 €

GEN8933563217 VA - β - MSH, Lipotropin - γ, Proopiomelanocortin – derived (AA: Val-Ala-Ala-Glu-Lys-Lys-Asp-Glu-Gly-Pro-Tyr-Arg-Met-Glu-His-Phe-Arg-Trp-Gly-Ser-Pro-Pro-Lys-Asp) (MW: 2831.19) ADI 1 mg 260 €

GEN4254535573 Melanocyte Associated Antigen gp100 (AA: Ala-Leu-Asn-Phe-Pro-Gly-Ser-Gln-Lys) (MW: 961.09) ADI 5 mg 260 €

GEN6644280047 Melanocyte Associated Antigen gp 100 (17 - 25) (AA: Ala-Leu-Leu-Ala-Val-Gly-Ala-Thr-Lys) (MW: 843.04) ADI 5 mg 260 €

GEN4738460007 [Lys0] - γ - 1 - MSH (41 - 58), amide [Lys-Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2; MW: 1641.1] ADI 5 mg 333 €

GEN3010840103 γ2 - MSH (41 - 58), amide [Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 (MW: 1569.82)] ADI 5 mg 333 €

GEN7259161601 β- MSH, porcine [Asp-Glu-Gly-Pro-Tyr-Lys-Met-Glu-His-Phe-Arg-Trp-Gly-Ser-Pro-Pro-Lys-Asp (MW: 2176.4)] ADI 1 mg 188 €

GEN3269049923 Alloferon 2 (AA: Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly) (MW: 1128.2) ADI 5 mg 333 €

GEN1822522338 Type B Allatostatin (AA: Ala-Tyr-Ser-Tyr-Val-Ser-Glu-Tyr-Lys-Arg-Leu-Pro-Val-Tyr-Asn-Phe-Gly-Leu-NH2) (MW: 2168.50) ADI 1 mg 188 €

GEN8127538902 Allatostatin IV (AA: Asp-Arg-Leu-Tyr-Ser-Phe-Gly-Leu-NH2) (MW: 969.1) ADI 5 mg 260 €

GEN5789544788 Allatostatin III (AA: Gly-Gly-Ser-Leu-Tyr-Ser-Phe-Gly-Leu-NH2) (MW: 899.02) ADI 5 mg 333 €

GEN5670766912 Allatostatin II (AA: Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2) (MW: 1067.2) ADI 5 mg 333 €

GEN5838378457 PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) (AA: Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2) (MW: 1062.2) ADI 5 mg 260 €

GEN9175558594 PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) (AA: Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2) (MW: 1403.71) ADI 5 mg 333 €

GEN7075256678 PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) (AA: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2) (MW: 2720.37) ADI 1 mg 260 €

GEN5890293227 Ac-PACAP-38 (human, mouse, ovine, porcine, rat) ADI 1 mg 478 €

GEN4635881118 Peptide YY (13-36) (canine, mouse, porcine, rat) ADI 1 mg 260 €

GEN1389322346 Peptide YY (3-36) (canine, mouse, porcine, rat) ADI 1 mg 333 €

GEN2200444146 [Leu31,Pro34]-Peptide YY (human) [Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Ala-Aib-Arg-Gln-Arg-Tyr-NH2; MW: 4207.73] ADI 1 mg 405 €

GEN8699276184 Pancreatic Polypeptide (31-36) (free acid) (human) ADI 5 mg 188 €

GEN5472656563 Pancreatic Polypeptide (31-36) (human) ADI 5 mg 188 €

GEN4767513065 Pancreatic Polypeptide (rana temporaria) ADI 1 mg 405 €

GEN9774136717 Pancreatic Polypeptide (human) ADI 1 mg 405 €

GEN2301366128 Pancreatic Polypeptide (bovine) ADI 1 mg 405 €

GEN7490971938 [Thr46]-Osteocalcin (45-49) (human) ADI 5 mg 188 €

GEN1542519493 Osteocalcin (45-49) (human) ADI 5 mg 188 €

GEN7334169772 [Tyr38,Phe42,46]-Osteocalcin (38-49) (human) ADI 5 mg 333 €

GEN6173817481 Osteocalcin (37-49) (human) ADI 5 mg 333 €

GEN1201990641 [Ala11, D-Leu15]-Orexin B (human) ADI 1 mg 333 €

GEN9500749360 Hypocretin (70-98) (human) ADI 1 mg 333 €

GEN4956039820 Biotin-Obestatin (rat) ADI 1 mg 260 €

GEN5447160668 Biotin-Obestatin (human) ADI 1 mg 260 €

GEN3513866316 Neurotrophic Factor for Retinal Cholinergic Neurons ADI 5 mg 333 €

GEN5475397564 Brain Injury Derived Neurotrophic Peptide ADI 5 mg 333 €

GEN3457066054 [Val4]-Angiotensin III ADI 5 mg 188 €

GEN8067310602 [Sar1]-Angiotensin I/II (1-7) amide ADI 25 mg 333 €

GEN7860539736 [Sar1,Val5,Ala8]-Angiotensin II ADI 25 mg 333 €

GEN2386057465 [Sar1,Thr8]-Angiotensin II ADI 25 mg 333 €

GEN9768658497 [Sar1,Gly8]-Angiotensin II ADI 25 mg 333 €

GEN8531911855 [Sar1,Ala8]-Angiotensin II ADI 25 mg 333 €

GEN7311118632 Angiotensin A ADI 5 mg 260 €

GEN1640976366 PRRS-RSAB-C ADI 1 mg 188 €

GEN3746325183 PRRS-RSAB-N ADI 5 mg 333 €

GEN5437606920 PRRS-PQGAB-C ADI 5 mg 333 €

GEN2063547205 PRRS-PQGAB-M ADI 5 mg 333 €

GEN3114316315 PRRS-PQGAB-N ADI 1 mg 188 €

GEN6860218300 HPV-E6-C ADI 1 mg 188 €

GEN2607707624 HPV-E6-M ADI 1 mg 260 €

GEN1413899620 HPV-E6-N ADI 1 mg 333 €

GEN9691323532 HPV-E7-C ADI 1 mg 260 €

GEN2027427318 HPV-E7-N ADI 1 mg 260 €

GEN5799553054 HIV-gp120-41-C ADI 1 mg 188 €

GEN4257920050 HIV-gp120-41-N-B ADI 1 mg 188 €

GEN9992015743 HIV-gp120-41-N-A ADI 1 mg 188 €

GEN7759780713 [Tyr15]-Fibrinopeptide B ADI 5 mg 333 €

GEN8210594644 Fibrinopeptide B ADI 1 mg 188 €

GEN6987674755 Exendin 4 (1-8) ADI 5 mg 260 €

GEN7239025714 Epidermal Mitosis Inhibiting Pentapeptide ADI 5 mg 333 €

GEN8425542829 EGF Receptor (988-993) (phosphorylated) (human) ADI 1 mg 188 €

GEN1428377535 Ac-[Cys(Acm)33,42]-EGF (33-42) amide (mouse) ADI 5 mg 333 €

GEN9999310911 [Des-Leu26,Cys(Acm)20,31]-EGF (20-31) ADI 5 mg 333 €

GEN3767809159 [Cys(Acm)20,31]-EGF (20-31) ADI 5 mg 333 €

GEN6422933495 Band 3 Protein (824-829) (human) ADI 5 mg 188 €

GEN6884714283 Band 3 Protein (547-553) (human) ADI 5 mg 188 €

GEN6313275851 TA-0910, taltirelin (AA: 1-methyl-4,5-dihydroorotyl-His-Pro-NH2) (MW: 405.41) ADI 5 mg 260 €

GEN8130759845 Ac-Gastrin Releasing Peptide (GRP) (20-26) (human, porcine, canine) ADI 5 mg 260 €

GEN5961060817 Gastrin Releasing Peptide (GRP) (14-27) (human, porcine, canine) ADI 5 mg 333 €

GEN9963798748 Gastrin Releasing Peptide (GRP) (1-16) (porcine) ADI 1 mg 188 €

GEN3888358937 Minigastrin I (human) ADI 5 mg 333 €

GEN3183794539 Gastrin I (rat) ADI 1 mg 188 €

GEN3875289867 Gastrin I (1-14) (human) ADI 1 mg 188 €

GEN6121184547 [Leu15]-Gastrin I (human) ADI 1 mg 260 €

GEN9508527595 Biotin-[Glu1]-Gastrin I (human) (phosphorylated) ADI 1 mg 260 €

GEN8985959683 Biotin-[Gln1]-Gastrin I (human) ADI 1 mg 260 €

GEN5915914882 Gastric Inhibitory Polypeptide (GIP, 6-30) amide (human) ADI 1 mg 260 €

GEN5155605786 [Thr4,Gly7]-Oxytocin ADI 5 mg 188 €

GEN4394193220 [Ser4,Ile8]-Oxytocin ADI 5 mg 405 €

GEN3029072201 [Phe2,Orn8]-Oxytocin ADI 5 mg 405 €

GEN3462365494 [Ile8]-Oxytocin ADI 5 mg 333 €

GEN5492358938 Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) ADI 5 mg 188 €

GEN9371442636 Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) ADI 5 mg 188 €

GEN3608091274 Osteostatin amide (human) ADI 1 mg 260 €

GEN3502603973 Pneumadin (rat) ) ADI 5 mg 333 €

GEN6916563652 Pneumadin (human) ADI 5 mg 333 €

GEN8508611752 Platelet Factor 4, PF4, PF4 (58-70) (human) ADI 5 mg 333 €

GEN7199486350 [Gln18]-Platelet Factor 4, PF4 (15-22) (human) ADI 5 mg 260 €

GEN2324862855 Ac-[Leu28,31]-Neuropeptide Y (NPY) (24-36) ADI 5 mg 333 €

GEN1813357158 Neuropeptide Y (NPY) (22-36) ADI 1 mg 188 €

GEN2588223303 Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (NPY) (18-36) (human) ADI 1 mg 405 €

GEN4948028993 Neuropeptide Y (NPY) (18-36) ADI 1 mg 188 €

GEN6392419213 Neuropeptide Y (NPY) (13-36) (porcine) ADI 1 mg 260 €

GEN9503622253 [Leu31,Pro34]-Neuropeptide Y (NPY) (13-36) (human, rat) ADI 1 mg 260 €

GEN4883079843 Neuropeptide Y (NPY) (13-36), human ADI 1 mg 260 €

GEN1648127431 Neuropeptide Y (NPY) (3-36) (porcine) ADI 1 mg 333 €

GEN6033190034 Neuropeptide Y (NPY) (2-36), amide, porcine ADI 1 mg 333 €

GEN2550613043 Neuropeptide Y (NPY) (2-36) (human, rat) ADI 1 mg 333 €

GEN1216914428 Neuropeptide Y (NPY) (1-24) amide (human, rat) ADI 1 mg 260 €

GEN6086056242 [D-Trp32]-Neuropeptide Y (NPY) (porcine) ADI 1 mg 333 €

GEN4451398958 [Pro34]-Neuropeptide Y (NPY) (porcine) ADI 1 mg 333 €

GEN2848605926 [Leu31,Pro34]-Neuropeptide Y (NPY) (porcine) ADI 1 mg 333 €

GEN7580603103 [Ala31, Aib32]-Neuropeptide Y (NPY) (porcine) ADI 1 mg 188 €

GEN1371693361 Neuropeptide Y (NPY) (porcine) ADI 1 mg 333 €

GEN4682419672 [D-Trp32]-Neuropeptide Y (NPY) (human) ADI 1 mg 333 €

GEN8427087290 [Leu31,Pro34]-Neuropeptide Y (NPY) (human, rat) ADI 1 mg 333 €

GEN2880418549 Biotin-Neuropeptide Y (NPY) (human, rat) ADI 1 mg 333 €

GEN1178427446 Neuropeptide W-30 (rat) ADI 1 mg 260 €

GEN8783685037 Nesfatin-1 (rat) ADI 1 mg 2443 €

GEN2704459851 Nesfatin-1 (mouse) ADI 1 mg 913 €

GEN7160635643 Nesfatin-1 (human) ADI 1 mg 913 €

GEN3634863177 α-Neoendorphin (1-8) ADI 5 mg 260 €

GEN9391607925 Proadrenomedullin (12-20) (human) ADI 5 mg 333 €

GEN7936944844 Proadrenomedullin (1-20) (human) ADI 1 mg 188 €

GEN6159569072 Proadrenomedullin (45-92) (human) ADI 1 mg 405 €

GEN6074209710 Adrenomedullin (Adrenomedullin (ADM/AM, 26-52) (human) ADI 1 mg 260 €

GEN4644941550 Adrenomedullin (Adrenomedullin (ADM/AM, 16-31) (human, pig) ADI 1 mg 333 €

GEN9467334802 Adrenomedullin (Adrenomedullin (ADM/AM, 11-50) (rat) ADI 1 mg 623 €

GEN9475731790 Adrenomedullin (ADM/AM, 1-50), rat ADI 1 mg 623 €

GEN9995922776 Adipokinetic Hormone (Apis mellifera ligustica, Bombyx mori, Heliothis zea, Manduca sexta) ADI 5 mg 260 €

GEN7045387911 [Leu116]-Prepro-Neuromedin U (NmU, 104-136) (human) ADI 1 mg 333 €

GEN8625827974 Prepro-Neuromedin U (NmU, 104-136) (human) ADI 1 mg 333 €

GEN8625339745 Biotin-Neuromedin S (NMS, rat) ADI 1 mg 333 €

GEN7443218049 Neuromedin S (NMS, rat) ADI 1 mg 333 €

GEN2010956100 Prepro-Neuromedin S (NMS, 70-103) (human) ADI 1 mg 333 €

GEN8132432641 Biotin-Neuromedin S (NMS, human) ADI 1 mg 1377 €

GEN9785440038 Neuromedin S (NMS, human) ADI 1 mg 333 €

GEN6720771492 [D-Pro2,D-Trp6,8,Nle10]-Neurokinin B (Tachykinin-3) ADI 5 mg 333 €

GEN3778671529 [Pro7]-Neurokinin B (Tachykinin-3) ADI 5 mg 333 €

GEN7435165300 Biotin-Neurokinin B (Tachykinin-3) ADI 5 mg 333 €

GEN7313445856 [Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10) ADI 5 mg 333 €

GEN6913591233 [Trp7,β-Ala8]-Neurokinin A (4-10) ADI 5 mg 260 €

GEN1557404320 [Nle10]-Neurokinin A (4-10) ADI 5 mg 188 €

GEN1118658019 [β-Ala8]-Neurokinin A (4-10) (Asp-Ser-Phe-Val-β-Ala-Leu-Met-NH2; MW: 781) ADI 5 mg 260 €

GEN9052342140 Rabbit Anti-Soy protein antiserum, IgG ADI 100 μL 536 €

GEN1342581458 Rabbit Anti-Soy protein antiserum, IgG ADI 100 μL 536 €

GEN9128826962 Sarcosine oxidase (20 U/mg material) ADI 20 KU 695 €

GEN6917747931 Human Sclerostin protein Control/blocking peptide # 1 ADI 100 μg 188 €

GEN3610762314 Rabbit Anti-human Sclerostin protein ADI 100 μg 565 €

GEN8287186821 Goat Anti-Mouse Superoxide Dismutase 3 (SOD3/EC-SOD) ADI 100 μL 565 €

GEN3488829216 Human Superoxide Dismutase 3 (SOD3) control/blocking peptide ADI 100 μg 188 €

GEN8179955193 Rabbit Anti-human Superoxide Dismutase 3 (SOD3) IgG ADI 100 μg 565 €

GEN8332186718 Mouse Monoclonal Anti-human Superoxide Dismutase 2 (SOD2/MnSOD) protein IgG ADI 100 μL 565 €

GEN2187309513 Human Superoxide Dismutase 2 (SOD2/MnSOD)-GST fusion protein control for western ADI 100 μL 333 €

GEN4341885942 Sheep Anti-human Superoxide Dismutase 2 (SOD2) protein ADI 100 μL 565 €

GEN9879317272 Mouse Monoclonal Anti-human Superoxide Dismutase 1 (SOD1) protein ADI 100 μg 565 €

GEN3285579360 Recombinant purified human Superoxide Dismutase 1 (SOD1) protein control for WB ADI 100 μL 333 €

GEN3467075961 Sheep Anti-human Superoxide Dismutase 1 (SOD1) protein IgG ADI 100 μL 565 €

GEN3316688038 Superoxide dismutase (3000 U/mg material), Bovine erythrocytes ADI 20 KU 695 €

GEN3413912108 S-Nitroso-L-Glutathione, compound ADI 5 mg 217 €

GEN8855354658 S-Nitroso-L-Glutathione, compound ADI 10 mg 289 €

GEN2132773519 S-Nitrosylated-BSA protein conjugate for ELISA/antibody blocking ADI 100 μg 289 €

GEN5963089789 Sambucus nigra (SNA) coated plate for ELISA (sugar specificity: galactose, sialic acid), 5 plates/pk ADI 1 Pk 478 €

GEN3291299691 Sambucus Nigra bark Agglutinin (SNA) purified, unlabeled ADI 1 mg 188 €

GEN8646200897 Sambucus nigra Lectin (SNA)-HRP conjugate ADI 0,5 mL 333 €

GEN4142580640 Sambucus nigra Lectin (SNA)-FITC conjugate ADI 0,5 mL 333 €

GEN4715778100 Sambucus nigra Lectin (SNA)-biotin conjugate ADI 0,5 mL 333 €

GEN8259829625 Rat Sodium-dependent Multi-Vitamin Transporter (SMVT) ), control/blocking peptide # 1 ADI 100 μg 188 €

GEN8621369433 Rabbit Anti-Rat Sodium-dependent Multi-Vitamin Transporter (SMVT) IgG (aff pure) # 1 ADI 100 μg 565 €

GEN9397049990 Rabbit Anti-Sm-p80/Calpain/CANP (S. mansoni, 1-758aa, His-tag >95%) antiserum ADI 100 μL 536 €

GEN7447134525 Recombinant (E. coli) Sm-p80/Calpain/CANP (S. mansoni, 1-758aa, His-tag >95%) ADI 10 μg 768 €

GEN5025512928 Sulfo-SMCC (Sulfosuccinimidyl-trans-4-(N-maleimidomethyl)cyclohexane-1-carboxylate) (water soluble linker to couple cysteine-containing proteins and peptides to carrier proteins) ADI 50 mg 202 €

GEN3185959244 Mouse monoclonal Anti-S. mansoni IgG for IF/ELISA ADI 100 μL 565 €

GEN4314192915 Rabbit Anti-Bovine Smith antigen (Sm) ADI 100 μL 536 €

GEN4206737891 Purified Human Smith Antigen (Sm) WB +ve control ADI 100 μL 333 €

GEN6277859383 Recombinant (Sf9) Sm28/Smp28/GST28/GST-mu protein (S. Japonicum, 1-211aa, His-tag >95%, low endotoxin) ADI 50 μg 768 €

GEN2440841538 Monoclonal Anti-Sm28/Smp28/GST28/GST-mu protein (S. Japonicum) IgG ADI 100 μL 565 €

GEN5687906613 Monoclonal Anti-Sm28/Smp28/GST28/GST-mu protein (S. Japonicum) IgG-Biotin conj ADI 100 μL 594 €

GEN8675038066 Rabbit Anti-Sm28/Smp28/GST28/GST-mu protein (S. Japonicum, 1-211aa) antiserum ADI 100 μL 536 €

GEN4005851080 Recombinant (E. coli) Sm28/Smp28/GST28/GST-mu protein (S. Japonicum, 1-211aa, no-tag >95%) ADI 50 μg 768 €

GEN4424676694 Recombinant (E. coli) Sm28/Smp28/GST28/GST-mu protein (S. mansoni, 1-211aa, His-tag >95%) ADI 50 μg 768 €

GEN3302118235 Sm25 antigenic peptide (S. mansoni, 36-82 aa, >95%, low endotoxin) ADI 100 μg 478 €

GEN2887676410 Recombinant (E. coli) Sm23 protein (S. mansoni, 1-218aa, His-tag >95%) ADI 50 μg 768 €

GEN5748245433 Tak-285, dual Inhibitor of Her2/EGFR Tyr kinase (IC50=17 nM; mol wt 547; >98%) ADI 5 mg 405 €

GEN9604376418 Tak-285, dual Inhibitor of Her2/EGFR Tyr kinase (IC50=17 nM; mol wt 547; >98%) ADI 25 mg 1058 €

GEN7259729374 Arry-380, Oral, potent Inhibitor of Her2/Erbb2 Tyr kinase (IC50=8 nM; mol wt 869; >98%) ADI 5 mg 405 €

GEN7254562152 Arry-380, Oral, potent Inhibitor of Her2/Erbb2 Tyr kinase (IC50=8 nM; mol wt 869; >98%) ADI 25 mg 1058 €

GEN3128311826 Mubritinib (TAK-165), potent Inhibitor of Her2/Erbb2 (IC50=6 nm; mol wt 468; >98%) ADI 50 mg 449 €

GEN6806617112 Mubritinib (TAK-165), potent Inhibitor of Her2/Erbb2 (IC50=6 nm; mol wt 468; >98%) ADI 10 mg 159 €

GEN9479734967 AEE788 (NVP-AEE788), dual Inhibitor of Her2/Erbb2/EGFR (mol wt 440; >98%) ADI 5 mg 260 €

GEN4802887845 AEE788 (NVP-AEE788), dual Inhibitor of Her2/Erbb2/EGFR (mol wt 440; >98%) ADI 25 mg 1275 €

GEN8853558971 AZD8931, reversible and competitive Inhibitor of Her2/Erbb2/ErbB3 (mol wt 473; >98%) ADI 5 mg 333 €

GEN2558616930 AZD8931, reversible and competitive Inhibitor of Her2/Erbb2/ErbB3 (mol wt 473; >98%) ADI 25 mg 840 €

GEN2962981344 CP-724,714, Potent and selective Inhibitor of Her2/Erb2 (mol wt 469; >98%) ADI 5 mg 188 €

GEN2968370491 CP-724,714, Potent and selective Inhibitor of Her2/Erb2 (mol wt 469; >98%) ADI 25 mg 623 €

GEN1793096192 Canertinib (CI-1033), kinase Inhibitor of Her2/Erb2/EGFR (mol wt 485; >98%) ADI 50 mg 405 €

GEN8022257466 Canertinib (CI-1033), kinase Inhibitor of Her2/Erb2/EGFR (mol wt 485; >98%) ADI 10 mg 159 €

GEN3785988217 Lapatinib Ditosylate (GW572016, GW2016, Tykerb, Tyverb), Autophos. Inhibitor of Her2/Erb2 (mol wt 925; >98%) ADI 25 mg 159 €

GEN9312464583 Lapatinib Ditosylate (GW572016, GW2016, Tykerb, Tyverb), Autophos. Inhibitor of Her2/Erb2 (mol wt 925; >98%) ADI 100 mg 333 €

GEN7384331706 Cell permeable Inhibitor of EGFR2/FGFR/PDGFr/JAK1/Her2 ((E)-4-((4-)1H-1,2,3-Triazol-1-yl)butyl)phenoxy)methyl)-2-(4-trifluoromethyl)oxazole, mol wt 468; >98%) ADI 100 mg 913 €

GEN3901316099 Cell permeable Inhibitor of EGFR2/FGFR/PDGFr/JAK1/Her2 ((E)-4-((4-)1H-1,2,3-Triazol-1-yl)butyl)phenoxy)methyl)-2-(4-trifluoromethyl)oxazole, mol wt 468; >98%) ADI 10 mg 188 €

GEN3914657024 Cell permeable Inhibitor of EGFR/ERB family/Her2 (Neratinib/HKI-272, mol wt 557.04; >98%) ADI 5 mg 188 €

GEN6492680305 Cell permeable Inhibitor of EGFR/ERB family/Her2 (Neratinib/HKI-272, mol wt 557.04; >98%) ADI 25 mg 623 €

GEN9812120894 Lapatinib, Inhibitor of Her2/EGFR (IC50=10 nM; mol wt 581; >98%) ADI 25 mg 188 €

GEN5868159536 Lapatinib, Inhibitor of Her2/EGFR (IC50=10 nM; mol wt 581; >98%) ADI 100 mg 405 €

GEN6309845285 Inhibitor of EGFR/HDAC/Her2 (CUDC-101; 7-((4-((3-ethynylphenyl)amino)-7-methoxyquinazolin-6-yl)oxy)-N-hydroxyheptanamide, Mol wt 434.49, >99%) ADI 50 mg 623 €

GEN8107713521 Inhibitor of EGFR/HDAC/Her2 (CUDC-101; 7-((4-((3-ethynylphenyl)amino)-7-methoxyquinazolin-6-yl)oxy)-N-hydroxyheptanamide, Mol wt 434.49, >99%) ADI 10 mg 188 €

GEN7563259657 Inhibitor of EGFR/HER family (Her1, Her2, Her3 or Pan Her-inhibitor) (BMS-59926/AC480, Mol wt 567.01, >99%) ADI 50 mg 1203 €

GEN2476738533 Inhibitor of EGFR/HER family (Her1, Her2, Her3 or Pan Her-inhibitor) (BMS-59926/AC480, Mol wt 567.01, >99%) ADI 5 mg 260 €

GEN1884467288 EGFR/HER2 kinase inhibitor (>99%, M.wt 485.94) (Afatinib/BIBW-2992 ADI 50 mg 768 €

GEN6970868202 EGFR/HER2 kinase inhibitor (>99%, M.wt 485.94) (Afatinib/BIBW-2992 ADI 5 mg 188 €

GEN2757583627 Monoclonal Mouse Monoclonal Anti-Salmonella LPS core ADI 0.1 ml 565 €

GEN8719234628 Monoclonal Mouse Monoclonal Anti-Salmonella LPS core IgG, aff pure ADI 0,1 mL 565 €

GEN5434591186 Monoclonal Mouse Monoclonal Anti-Salmonella typhimurium gp B LPS IgG, aff pure ADI 0,1 mL 565 €

GEN4961723176 Monoclonal Mouse Monoclonal Anti-Salmonella typhimurium gp B LPS ADI 0.1 ml 565 €

GEN4137087393 Rabbit Anti-Salmonella IgG-HRP conjugate ADI 0,5 mL 405 €

GEN7197316237 Rabbit Anti-Salmonella IgG-FITC conjugate ADI 0,5 mL 405 €

GEN3419559764 Rabbit Anti-Salmonella IgG-biotin conjugate ADI 0,5 mL 405 €

GEN8213940503 Rabbit Anti-Salmonella IgG, aff pure ADI 0,5 mL 333 €

GEN6173751145 BSA-sialic acid coated plates for lectin testing by ELISA, 5 plates/pk ADI 1 Pk 478 €

GEN7033365169 N-AcetyIneuraminic Acid, Sialic acid; NANA; Neu5Ac ADI 5 mg 188 €

GEN5807859103 Inhibitory iODN- class I/II hybrid, may also affect TLR7 and TLR8 signaling. ADI 100 μg 260 €

GEN6425056075 Rabbit Anti-Human Sialin antiserum ADI 100 μL 536 €

GEN7456550038 Human Sialin control/blocking peptide ADI 100 μg 188 €

GEN4879276819 Rabbit Anti-Human sialin aff pure, IgG ADI 100 μg 565 €

GEN8719246633 Custom production of antibodies in 1 Sheep using supplied antigen (std 63 days protocol) ADI 1 1348 €

GEN9486448606 Human Sex Hormone-Binding Globulin (SHBG), purified ADI 100 μg 623 €

GEN4086604045 Monoclonal Anti-human Sex hormone-binding globulin (SHBG/SSBG) IgG # 2, aff pure ADI 100 μg 565 €

GEN4991458583 Monoclonal Anti-human Sex hormone-binding globulin (SHBG/SSBG) ADI 100 μg 565 €

GEN6430094972 Purified human serum Sex hormone-binding globulin (SHBG/SSBG) protein control for western ADI 100 μL 333 €

GEN5056561646 Rabbit Anti-Ebola-Mayinga, Zaire soluble glycoprotein peptide antiserum ADI 100 μL 0 €

GEN9919419758 Rabbit Anti-Pig Sod. Gluc. Transp. 3 (SGLT-3/SAAT1) ADI 100 μL 536 €

GEN5488997999 Pig Sod. Gluc. Transp. 3 (SGLT-3/SAAT1) Control/blocking peptide #2 ADI 100 μg 188 €

GEN5319626094 Rabbit Anti-Pig Sod. Gluc. Transp. 3 (SGLT-3/SAAT1) ADI 100 μg 565 €

GEN5897311908 Rabbit Anti-Pig Sod. Gluc. Transp. 3 (SGLT-3/SAAT1) ADI 100 μL 536 €

GEN2215162947 Pig Sod. Gluc. Transp. 3 (SGLT-3) Control/blocking peptide # 3 ADI 100 μg 188 €

GEN4102764370 Rabbit Anti-Pig Sod. Gluc. Transp. 3 (SGLT-3/SAAT1) IgG # 1, aff pure ADI 100 μg 565 €

GEN5324197879 Rabbit Anti-Human Sod. Gluc. Transp. 3 (SGLT-3) antiserum # 2 ADI 100 μL 536 €

GEN3835545419 Human Sod. Gluc. Transp. 3 (SGLT-3) Control/blocking peptide # 2 ADI 100 μg 188 €

GEN2831040121 Rabbit Anti-Human Sod. Gluc. Transp. 3 (SGLT-3) ADI 100 μg 565 €

GEN3144583219 Rabbit Anti-Mouse Sod. Gluc. Transp. 3 (SGLT-3) ADI 100 μL 536 €

GEN2892156223 Mouse Sod. Gluc. Transp. 3 (SGLT-3) Control/blocking peptide # 1 ADI 100 μg 188 €

GEN9962288575 Rabbit Anti-Mouse Sod. Gluc. Transp. 3 (SGLT-3) ADI 100 μg 565 €

GEN9037430871 Rabbit Anti-Human Sod. Gluc. Transp. 2 (SGLT-2) antiserum # 2 ADI 100 μL 536 €

GEN2096259673 Human Sod. Gluc. Transp. 2 (SGLT-2) Control/blocking peptide # 2 ADI 100 μg 188 €

GEN2150623938 Rabbit Anti-Human Sod. Gluc. Transp. 2 (SGLT-2) ADI 100 μg 565 €

GEN9305209932 Rabbit Anti-Rat Sod. Gluc. Transp. 2 (SGLT-2) antiserum # 1 ADI 100 μL 536 €

GEN6635289896 Rat Sod. Gluc. Transp. 2 (SGLT-2) Control/blocking peptide # 1 ADI 100 μg 188 €

GEN4044254729 Rabbit Anti-Rat Sod. Gluc. Transp. 2 (SGLT-2) IgG # 1, aff pure ADI 100 μg 565 €

GEN5791559774 Rabbit Anti-Human Sod. Gluc. Transp. 1 (SGLT-1) antiserum # 3 ADI 100 μL 536 €

GEN9318572984 Human Sod. Gluc. Transp. 1 (SGLT-1) Control/blocking peptide # 3 ADI 100 μg 188 €

GEN2214767959 Rabbit Anti-Human Sod. Gluc. Transp. 1 (SGLT-1) IgG # 3, aff pure ADI 100 μg 565 €

GEN1205334258 Rabbit Anti-Rat Sod. Gluc. Transp. 1 (SGLT-1) antiserum # 2 ADI 100 μL 536 €

GEN2639397838 Rat Sod. Gluc. Transp. 1 (SGLT-1) Control/blocking peptide # 2 ADI 100 μg 188 €

GEN7666564147 Rabbit Anti-Rat Sod. Gluc. Transp. 1 (SGLT-1) IgG # 2, aff pure ADI 100 μg 565 €

GEN1809912450 Rabbit Anti-Mouse Sod. Gluc. Transp. 1 (SGLT-1) antiserum # 1 ADI 100 μL 536 €

GEN8643859929 Mouse Sod. Gluc. Transp. 1 (SGLT-1) Control/blocking peptide # 1 ADI 100 μg 188 €

GEN7086067598 Rabbit Anti-Mouse Sod. Gluc. Transp. 1 (SGLT-1) ADI 100 μg 565 €

GEN8086340752 Recombinant (E. coli) Seneca Valley Virus (SeV/SVV) VP1 protein (>95%, his-tag) ADI 10 μg 478 €

GEN1613439438 Rabbit Anti-Seneca valley Virus (SeV/SVV) VP1 antiserum ADI 100 μL 536 €

GEN3668476690 Recombiant (E. Coli) Seneca valley Virus (SeV/SVV) VP1 protein control for Western blot ADI 100 μL 333 €

GEN6384090058 Drosophila Serotonin Transporter (SERT) Control/blocking peptide ADI 100 μg 188 €

GEN4139726366 Rabbit Anti-Drosophila Serotonin Transporter (SERT) IgG, aff pure ADI 100 μg 565 €

GEN1675863684 Human Serotonin Transporter (SERT) Control/blocking peptide #2 ADI 100 μg 188 €

GEN5744215429 Rabbit Anti-Human Serotonin Transporter (SERT) IgG #2, aff pure ADI 100 μg 565 €

GEN9759525588 Rabbit Anti-Rat Serotonin Transporter (SERT) antiserum #1 ADI 100 μL 536 €

GEN8596135189 Rat Serotonin Transporter (SERT) Control/blocking peptide #1 ADI 100 μg 188 €

GEN3913040982 Rabbit Anti-Rat Serotonin Transporter (SERT) IgG #1, aff pure ADI 100 μg 565 €

GEN2989420274 Monoclonal anti-serotonin antibody supernatant ADI 0,5 mL 565 €

GEN2406723344 Monoclonal anti-serotonin antibody supernatant ADI 0.5 ml 565 €

GEN9818919361 Rabbit Anti-Serotonin antiserum ADI 100 μL 536 €

GEN1849517384 Monoclonal anti-Parainfluenza type 1 (HPIV-1) nucelocapsid protein IgG ADI 100 μL 565 €

GEN6363447686 Recombinant (yeast) Parainfluenza type 1 nucelocapsid protein (C35, full length, >95%, ~60 kda) ADI 10 μg 405 €

GEN6123708417 Monoclonal Anti-Sendai virus/Parainfluenza type 3 hemagluttinin (HA) protein (SeV/Parainfluenza virus 3, H) IgG (clone 2) ADI 100 μg 565 €

GEN9774124866 Monoclonal Anti-Sendai virus/Parainfluenza type 3 hemagluttinin (HA) protein (SeV/Parainfluenza virus 3, H) IgG (clone 1) ADI 100 μg 565 €

GEN5352103557 Monoclonal Anti-Sendai virus/Parainfluenza type 1 fusion protein F (SeV/Parainfluenza virus 1, F) IgG ADI 100 μg 565 €

GEN9268620664 Canine Parainfluenza virus (CPiV) antigens (MDCK cells, inactivated, partially pure) for ELISA/Western ADI 100 μg 550 €

GEN7007115034 Sendai virus/Parainfluenza type 3 antigens (Vero cells, inactivated, partially pure) for ELISA/Western ADI 100 μL 405 €

GEN1861017103 Monoclonal Anti-Sendai virus/Parainfluenza type 3 (SeV/Parainfluenza virus 3) IgG ADI 100 μg 565 €

GEN7003994838 Sendai virus/Parainfluenza type 2 antigens (Vero cells, inactivated, partially pure) for ELISA/Western, Quantitative ADI 100 μL 405 €

GEN2108781630 Goat Anti-Sendai (Sev/Parainfluenza virus 2/3) antiserum ADI 100 μL 536 €

GEN7527297006 Monoclonal Anti-Parainfluenza virus 2 ADI 100 μL 565 €

GEN2861961041 Monoclonal Anti-Parainfluenza virus 2 IgG ADI 100 μL 565 €

GEN7040757708 Sendai virus/Parainfluenza type 1 antigens (Vero cells, inactivated, partially pure) for ELISA/Western ADI 100 μL 405 €

GEN8069760806 Monoclonal Anti-Sendai virus (SeV/Parainfluenza virus 1) IgG ADI 100 μL 565 €

GEN4517159826 Chicken Anti-Sendai/SeV/Parainfluenza virus 1 antibody positive control serum ADI 1 mL 260 €

GEN1381513730 Chicken Anti-Sendai/SeV/Parainfluenza virus 1 antibody negative control serum ADI 1 mL 188 €

GEN7669675281 Goat Anti-Sendai/(SeV/Parainfluenza virus 1) antiserum ADI 100 μL 536 €

GEN4339194487 Rat Anti-Sendai/(SeV/Parainfluenza virus 1) antibody positive control serum ADI 1 mL 260 €

GEN9766952749 Rat Anti-Sendai/(SeV/Parainfluenza virus 1) antibody negative control serum ADI 1 mL 188 €

GEN4347175520 Chicken Anti-Sendai/SeV/Parainfluenza virus 1 ADI 100 μL 536 €

GEN4606110581 Mouse Anti-Sendai/(SeV/Parainfluenza virus 1) antibody positive control serum ADI 1 mL 260 €

GEN5630268755 Mouse Anti-Sendai/(SeV/Parainfluenza virus 1) antibody negative control serum ADI 1 mL 188 €

GEN9509319036 Human Secretin (SECR) full length (27-aa) pure ADI 1 mg 260 €

GEN7907854056 Human Secretin (SECR) Control/blocking peptide #1 ADI 100 μg 188 €

GEN8537213183 Rabbit Anti-human Secretin (SECR) IgG #1, aff pure ADI 100 μg 565 €

GEN1249632538 Rat Syntenin Control/blocking peptide #1 ADI 100 μg 188 €

GEN5055926594 Rabbit Anti-Rat Syntenin ADI 100 μg 565 €

GEN6683212206 Recombinat (E. coli)Rat sialodacryoadenitis Virus (SDAV) nucleoprotein (>95%, His-tag, 48 kda) ADI 10 μg 478 €

GEN5581660251 Rabbit Anti-Rat sialodacryoadenitis Virus (SDAV) nucleoprotein antiserum ADI 100 μL 536 €

GEN8723587432 Rat Anti-Rat sialodacryoadenitis Virus (SDAV) nucleoprotein antibody positive control serum ADI 1 mL 260 €

GEN2399013155 Rat Anti-Rat sialodacryoadenitis Virus (SDAV) nucleoprotein antibody negative control serum ADI 1 mL 188 €

GEN8976102099 Recombinant Rat sialodacryoadenitis Virus (SDAV) nucleoprotein control for Western blot ADI 100 μL 333 €

GEN1399311356 Human Alpha Synuclein Recombinant deletion mutant protein (96-140aa) ADI 25μg 304 €

GEN8760590269 Human Alpha Synuclein Recombinant deletion mutant protein (61-140aa) ADI 25μg 304 €

GEN5250997746 Single channel mini-pipette (130 mm) set of 5 pipettes(5, 10, 20, 50, 100 ul), autoclavable (note: 1 free pipette of 25 ul included) ADI 1 268 €

GEN3392958055 Single channel mini-pipette (130 mm) 50 ul, autoclavable ADI 1 101 €

GEN4599348523 Single channel mini-pipette (130 mm) 5 ul, autoclavable ADI 1 101 €

GEN2453339942 Single channel mini-pipette (130 mm) 25 ul, autoclavable ADI 1 101 €

GEN4258568810 Single channel mini-pipette (130 mm) 20 ul, autoclavable ADI 1 101 €

GEN5031195689 Single channel mini-pipette (130 mm) 100 ul, autoclavable ADI 1 101 €

GEN5924105873 Single channel mini-pipette (130 mm) 10 ul, autoclavable ADI 1 101 €

GEN3742587311 Recombinant (sf9) Human Scl-70 protein (>95%, His-tag) ADI 10 μg 333 €

GEN8398141335 Monoclonal Anti-Human Scl-70 IgG ADI 100 μL 565 €

GEN8398440169 Recombinant (sf9) Human Scl-70 protein WB +ve control ADI 100 μL 333 €

GEN6533482759 Mouse Steroyl-CoA desaturase-1 (SCD-4) control/blocking peptide #1 ADI 100 μg 188 €

GEN6355918802 Rabbit Anti-Mouse Steroyl-CoA desaturase-4 (SCD-4) IgG, Aff. Pure ADI 100 μg 565 €

GEN7926148609 Mouse Steroyl-CoA desaturase-1 (SCD-3) control/blocking peptide #1 ADI 100 μg 188 €

GEN6147304410 Rabbit Anti-Mouse Steroyl-CoA desaturase-3 (SCD-3) IgG #1, Aff. Pure ADI 100 μg 565 €

GEN7333562128 Human Steroyl-CoA desaturase-1 (SCD-1) control/blocking peptide #1 ADI 100 μg 188 €

GEN3306830404 Rabbit Anti-Human Steroyl-CoA desaturase-1 (SCD-1) IgG #1, Aff. Pure ADI 100 μg 565 €

GEN9201020135 Recombinant (HEK) SARS Coronavirus Spike S1 protein (His-tag) ADI 10 μg 405 €

GEN4487366703 Purified Human Serum Amyloid P Component (SAP) protein ADI 100 μg 289 €

GEN8159792235 Monoclonal Anti-human Serum Amyloid P Component (SAP) IgG # 3, aff pure ADI 100 μg 565 €

GEN8064133544 Rabbit Anti-Human Serum Amyloid P Component (SAP) antiserum # 2 ADI 100 μL 536 €

GEN3114325493 Mouse Serum Amyloid P Component (SAP) Reference serum ADI 100 μL 376 €

GEN9335904903 Purified Human Serum amyloid P (SAP) Protein control for WB ADI 100 μL 333 €

GEN2005603871 Human Salivary Amylase protein positive control for WB ADI 100 μL 333 €

GEN1596051504 Rabbit Anti-Human Salivary Amylase IgG ADI 100 μL 478 €

GEN3542791364 StainAll dye for the visualization of proteins on membranes (transfer) ADI 500 mL 159 €

GEN4868128499 Mouse Monoclonal Anti-S Antigen (Sag) (P. falciparum) IgG, aff pure #2 ADI 100 μg 565 €

GEN5192404333 Mouse Monoclonal Anti-S Antigen (Sag) (P. falciparum) ADI 100 μg 565 €

GEN5222901296 Human Serum Amyloid A (SAA) protein, pure >95% ADI 25 μg 478 €

GEN4785660233 Monoclonal Anti-human Serum Amyloid A (SAA) IgG, pure ADI 100 μg 565 €

GEN2080376188 Purified Human Serum amyloid A (SAA) Protein control for WB ADI 100 μL 333 €

GEN2781391623 Goat Anti-human Serum Amyloid A (SAA) ADI 100 μL 565 €

GEN3343526862 Monoclonal Anti-Anthrax Spore extract antigen ADI 100 μg 565 €

GEN1908709308 Monoclonal Anti-Anthrax Spore extract antigen IgG-biotinylated, aff pure ADI 50 μL 478 €

GEN2328093258 Monoclonal Anti-Anthrax Spore extract antigen IgG # 2, aff pure ADI 100 μg 565 €

GEN5115663149 Rabbit Anti-Anthrax Spore extract antigen (90 kda), aff pure IgG #1 ADI 100 μg 565 €

GEN2712312382 Monoclonal Anti-Bovine S100 beta ab ADI 100 μL 565 €

GEN3690545609 Purified Bovine S100 beta control protein for WB in sample buffer ADI 100 μL 333 €

GEN7047291792 Monoclonal Anti-Bovine S100 alpha ab ADI 100 μL 565 €

GEN5778181909 Purified Bovine S100 alpha control protein for WB in sample buffer ADI 100 μL 333 €

GEN3302814480 Purified, Human S100 protein for ELISA or Standards ADI 100 μg 376 €

GEN7519709646 Purified, Human S100 protein control for WB ADI 100 μL 333 €

GEN7295544501 Purified, Bovine S100 protein for ELISA or Standards ADI 200 μg 376 €

GEN7758250238 Purified, Bovine S100 protein control for WB ADI 100 μL 333 €

GEN5535235838 Rabbit Anti-Bovine S100 IgG # 1, aff pure ADI 100 μg 565 €

GEN7594882852 Horse Anti-Russell's Viper (Vipera russelli) venom antiserum ADI 100 μL 536 €

GEN2450316880 Chicken Anti-Russell's Viper (Vipera russelli) venom antiserum ADI 100 μL 536 €

GEN9203667384 Rabbit Anti-Russell's Viper (Vipera russelli) venom antiserum ADI 100 μL 536 €

GEN5176385042 Recombinant (E.coli) Rift Valley Fever Virus NP protein (RVFV-NP) (His-tag, 27 kDa) purified ADI 10 μg 405 €

GEN7282593091 Recombinant (E.coli) Rift Valley Fever Virus non-structural protein (RVFV-NS) (His-tag, 27 kDa) purified ADI 10 μg 405 €

GEN9907247507 Monoclonal Anti-M. tuberculosis Rv2623 dormant protein from H37Rv strain IgG ADI 100 μL 565 €

GEN1481753911 Monoclonal Anti-M. tuberculosis Rv2031 dormant protein from H37Rv strain ADI 100 μL 565 €

GEN6004294792 Monoclonal Anti-M. tuberculosis Rv1734 dormant protein from H37Rv strain IgG ADI 100 μL 565 €

GEN8715800597 TruStrip RDT Canine distemper virus (hardpad disease) antigen rapid test card, results is 2-10 mins, 50 cards/pk ADI 1 pk 0 €

GEN8502036686 Humanized Antibody Hendra Virus (Hev) glycoprotein IgG ELISA Kit, quantitative, 96 tests ADI 1 kit 1203 €

GEN5734751549 Horse Anti-Hendra Virus (Hev) glycoprotein IgG ELISA Kit, quantitative, 96 tests ADI 1 kit 0 €

GEN3433009686 Pig Anti-Hendra Virus (Hev) glycoprotein IgG ELISA Kit, quantitative, 96 tests ADI 1 kit 0 €

GEN4184757270 Monkey Anti-Hendra Virus (Hev) glycoprotein IgG ELISA Kit, quantitative, 96 tests ADI 1 kit 985 €

GEN7604426490 Human Anti-Hendra Virus (Hev) glycoprotein IgG ELISA Kit, quantitative, 96 tests ADI 1 kit 985 €

GEN9939502071 Mouse Anti-Hendra Virus (Hev) glycoprotein IgG ELISA Kit, quantitative, 96 tests ADI 1 kit 0 €

GEN3628147861 Pig/Swine Anti-African Swine fever virus (ASFV) IgG ELISA Kit, quantitative, 96 tests ADI 1 kit 0 €

GEN7327911997 Pig/Swine Anti-African Swine fever virus (ASFV) IgG positive control serum ADI 1 mL 260 €

GEN3296366372 Pig/Swine Anti-African Swine fever virus (ASFV) IgG negative control serum ADI 1 mL 188 €

GEN6602685844 Goat and Sheep Anti-Peste des petits ruminants (PPR)/Rinderpest (RPR) IgG ELISA kit, quantitative, 96 tests ADI 1 kit 768 €

GEN3278575786 Sheep/Goat Anti-Lumpy Skin Disease virus (LSDV) IgG ELISA kit, 96 tests ADI 1 kit 666 €

GEN7475706537 Sheep Anti-Lumpy Skin Disease virus (LSDV) positive control serum ADI 1 mL 260 €

GEN4057284848 Sheep Anti-Lumpy Skin Disease virus (LSDV) negative control serum ADI 1 mL 188 €

GEN6171275574 Bovine Anti-Lumpy skin disease virus (LSDV) IgG ELISA kit, quantitative, 96 tests ADI 1 kit 985 €

GEN9267277584 Bovine Anti-Lumpy skin disease virus (LSDV) positive control serum ADI 1 mL 260 €

GEN4664966381 Bovine Anti-Lumpy skin disease virus (LSDV) negative control serum ADI 1 mL 188 €

GEN2167622535 RecomBac Bovine/Cow Leptospira LipL32 Protein IgG ELISA kit, 96 tests ADI 1 kit 0 €

GEN2102990777 Custom testing of animal/human samples for Anti-Leptospirosis LipL32 protein IgG ADI 1 kit 0 €

GEN7481018061 Pig/Swine Aanti-Leptospirosis LipL32 protein IgG Elisa kit, 96 tests, quantitative ADI 1 kit 0 €

GEN5306513235 Swine Anti-Leptospirosis LipL32 protein IgG positive control serum ADI 1 mL 260 €

GEN1133282317 Swine Anti-Leptospirosis LipL32 protein IgG negative control serum ADI 1 mL 188 €

GEN6274244892 Recombivirus Pig Corona virus (Bcov/BCV) nucleocapsid protein IgG ELISA kit, 96 tests ADI 1 kit 840 €

GEN7847772019 Recombivirus Mouse Anti-Bovine Coronavirus (BCov/BCV) nucleocapsid protein IgG ELISA kit, 96 tests, Quantitative ADI 1 kit 840 €

GEN1910330087 Recombivirus Monkey Corona virus (Bcov/BCV) nucleocapsid protein IgG ELISA kit, 96 tests ADI 1 kit 985 €

GEN6432457705 Recombivirus Human Corona virus (Bcov/BCV) nucleocapsid protein IgG ELISA kit, 96 tests ADI 1 kit 840 €

GEN7244495048 Recombivirus Pig Corona virus (Bcov/BCV) nucleocapsid protein IgG ELISA kit, 96 tests ADI 1 kit 840 €

GEN2781452542 Recombivirus Bovine Coronavirus (BCov/BCV) nucleocapsid protein IgG ELISA kit, 96 tests ADI 1 kit 840 €

GEN5857080790 Bovine Coronavirus (BCov/BCV) nucleocapsid protein IgG positive control serum ADI 1 mL 260 €

GEN8358249024 Bovine Coronavirus (BCov/BCV) nucleocapsid protein IgG negative control serum ADI 1 mL 188 €

GEN8616350204 Recombivirus Bovine/Cow Anti-Infectious Bovine Rhinotracheitis (IBR or BHV-1/BoHV-1) gE Protein IgG ELISA kit, 96 tests (DIVA Tests) ADI 1 kit 0 €

GEN7925588527 TruStrip RDT Cow/Bovine Infectious rhinitis (IBR) antibody rapid test card, results is 2-10 mins, 50 cards/pk ADI 1 pk 0 €

GEN1632114956 Recombivirus Bovine/Cow Anti-Infectious Bovine Rhinotracheitis (IBR or BHV-1/BoHV-1) gB Protein IgG ELISA kit, 96 tests ADI 1 kit 0 €

GEN3331950377 Bovine/Cow Infectious Bovine Rhinotracheitis (IBR or BHV-1/BoHV-1) gB Protein IgG positive control serum ADI 1 mL 260 €

GEN3817878833 Bovine/Cow Infectious Bovine Rhinotracheitis (IBR or BHV-1/BoHV-1) gB Protein IgG negative control serum ADI 1 mL 188 €

GEN8895716002 Recombivirus 1+2+3 Erns Protein antigen coated plates for ELISA (5x96 tests) ADI 1 pk 0 €

GEN3358074688 Recombivirus Mouse Anti-Bovine Viral Diarrhea Virus 1-3 (1-3) Erns Protein IgG ELISA kit, 96 tests ADI 1 kit 768 €

GEN6724678194 Recombivirus Rabbit Anti-Bovine Viral Diarrhea Virus 1-3 (1-3) Erns Protein IgG ELISA kit, 96 tests ADI 1 kit 768 €

GEN9324574090 Recombivirus Sheep/Goat Viral Diarrhea Virus (1-3) Erns Protein IgG ELISA kit, 5x96 tests (Not available in USA) ADI 1 kit 0 €

GEN7343360019 Recombivirus Sheep/Goat Viral Diarrhea Virus (1-3) Erns Protein IgG ELISA kit, 96 tests (Not available in USA) ADI 1 kit 0 €

GEN8802395768 Recombivirus Porcine Viral Diarrhea Virus (1-3) Erns Protein IgG ELISA kit, 5x96 tests (Not available in USA) ADI 1 kit 0 €

GEN9030698249 Recombivirus Porcine/Pig Viral Diarrhea Virus (1-3) Erns Protein IgG ELISA kit, 96 tests (Not available in USA) ADI 1 kit 0 €

GEN4526714756 Recombivirus Bovine Viral Diarrhea Virus (1-3) Erns Protein IgG ELISA kit, 5x96 tests (Not available in USA) ADI 1 kit 0 €

GEN2619939116 Recombivirus Bovine Viral Diarrhea Virus (1-3) Erns Protein IgG ELISA kit, 96 tests (Not available in USA) ADI 1 kit 0 €

GEN8106514434 Bovine Viral Diarrhea Virus (1-3) Erns IgG positive control serum ADI 1 mL 260 €

GEN2156828829 Bovine Viral Diarrhea Virus (1-3) Erns IgG negative control serum ADI 1 mL 188 €

GEN3118349685 Recombivirus 1+2+3 E2 Protein antigen coated plates for ELISA (5x96 tests), Quantitative ADI 1 pk 0 €

GEN8167905697 Recombivirus Mouse Anti-Bovine Viral Diarrhea Virus 1-3 (1+2+3) E2 Protein IgG ELISA kit, 96 tests, Quantitative ADI 1 kit 768 €

GEN1577569714 Recombivirus Rabbit Anti-Bovine Viral Diarrhea Virus 1-3 (1+2+3) E2 Protein IgG ELISA kit, 96 tests, Quantitative ADI 1 kit 768 €

GEN2547839912 Recombivirus Sheep/Goat Viral Diarrhea Virus 1-3 (1+2+3) E2 Protein IgG ELISA kit, 5x96 tests (Not available in USA) ADI 1 kit 0 €

GEN4542501443 Recombivirus Sheep/Goat Viral Diarrhea Virus 1-3 (1+2+3) E2 Protein IgG ELISA kit, 96 tests (Not available in USA) ADI 1 kit 0 €

GEN7921609559 Recombivirus Porcine/Pig Viral Diarrhea Virus 1+2+3 (1+2+3) E2 Protein IgG ELISA kit, 5x96 tests (Not available in USA) ADI 1 kit 0 €

GEN6452376126 Recombivirus Porcine/Pig Viral Diarrhea Virus 1+2+3 (1+3) E2 Protein IgG ELISA kit, 96 tests (Not available in USA) ADI 1 kit 0 €

GEN6032338764 Recombivirus Bovine Viral Diarrhea Virus 1+2+3 (1+2+3) E2 Protein IgG ELISA kit, 5x96 tests (Not available in USA) ADI 1 kit 0 €

GEN1413135371 Recombivirus Bovine Viral Diarrhea Virus 1+2+3 (1+3) E2 Protein IgG ELISA kit, 96 tests (Not available in USA) ADI 1 kit 0 €

GEN8010510961 Bovine Viral Diarrhea Virus 3 E2 (3 E2) IgG positive control serum ADI 1 mL 260 €

GEN6590393862 Bovine Viral Diarrhea Virus 3 E2 (3 E2) IgG negative control serum ADI 1 mL 188 €

GEN8782524993 Bovine Viral Diarrhea Virus 2 E2 (2 E2) IgG positive control serum ADI 1 mL 260 €

GEN2030130418 Bovine Viral Diarrhea Virus 2 E2 (2 E2) IgG negative control serum ADI 1 mL 188 €

GEN9003431028 Bovine Viral Diarrhea Virus1 E2 (1 E2) IgG positive control serum ADI 1 mL 260 €

GEN7661101305 Bovine Viral Diarrhea Virus1 E2 (1 E2) IgG negative control serum ADI 1 mL 188 €

GEN7906565445 RecombiVirus Goat/Sheep Anti-Rift Valley Fever Virus (RVFV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN5984949869 RecombiVirus Human Anti-Rift Valley Fever Virus (RVFV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN3374942616 RecombiVirus Mouse Anti-Rift Valley Fever Virus (RVFV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN4631606767 RecombiVirus Bovine/Cow Anti-Rift Valley Fever Virus (RVFV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN9925493411 RecombiVirus Pig/Swine Anti-Rift Valley Fever Virus (RVFV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN9153583802 RecombiVirus Mouse Anti-Seneca Valley Virus (SeV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN3058536025 RecombiVirus Bovine/Cow Anti-Seneca Valley Virus (SeV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN5928012550 RecombiVirus Pig/Swine Anti-Seneca Valley Virus (SeV) IgG ELISA kit, Quantitative, 96 tests ADI 1 kit 840 €

GEN4328683813 Monkey Anti-Wolbachia Surface Protein 26 (WSP26) IgG ELISA kit, 96 tests, Quantitative ADI 1 kit 985 €