Name : Recombinant E. coli Tryptophan Synthase α Chain, Trp A
Supplier : NOVO
Price :1613
SKU : GEN3361422724
| Reacts with | E, coli |
| Source | proteins, Recombinants or rec |
| Description | Recombinant E, coli Tryptophan synthase alpha chain is produced by our E, coli expression system and the target gene encoding Met1-Ser268 is expressed |
| Molecular Weight | 28, 7 kD |
| UniProt number | P0A877 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Group | recombinants |
| Gene target | Chain, Trp A, Tryptophan Synthase &alpha |
| Short name | Chain, Trp A, coli Tryptophan Synthase &alpha, Recombinant E |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host | Escherichia coli |
| Species | coli, E |
| Alternative name | L-tryptophan A, coli Tryptophan Synthase &alpha, epitope, recombinant E |
| Alternative technique | rec |