Name : Recombinant E. coli Tryptophan Synthase (N-6His)
Supplier : NOVO
Price :369
SKU : GEN8220863618
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant E, Thr2-Ile397 is expressed with a 6His tag at the N-terminus, coli Tryptophan synthase is produced by our E, coli expression system and the target gene encoding Met1-Ser268& |
| Molecular Weight | 5 kD, 72 |
| UniProt number | P0A877&, P0A879 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS&, MHHHHHHTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALTKCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGMFADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSISAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALKMMRENPDKEQLLVVNLSGRGDKDIFTVHDILKARGEI |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Group | recombinants |
| Gene target | Tryptophan Synthase (N-6His) |
| Short name | coli Tryptophan Synthase (N-6His), Recombinant E |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host | Escherichia coli |
| Species | E, coli, coli, E |
| Alternative name | coli Tryptophan Synthase (N-6His), recombinant E |
| Alternative technique | rec |