Name : Recombinant Human Bone Marrow Proteoglycan, BMPG (C-6His)
Supplier : NOVO
Price :202
SKU : GEN7903234998
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Bone Marrow Proteoglycan is produced by our Mammalian expression system and the target gene encoding Leu17-Tyr222 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 24, 6 kD |
| UniProt number | P13727 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSYVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | BMPG (C-6His), Bone Marrow Proteoglycan |
| Short name | BMPG (C-6His), Recombinant Bone Marrow Proteoglycan |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | BMPG (C-6His), sapiens Bone Marrow Proteoglycan, recombinant H |
| Alternative technique | rec |
| Identity | 9362 |
| Gene | PRG2 |
| Long gene name | pro eosinophil major basic protein , proteoglycan 2 |
| Synonyms gene name | bone marrow (natural killer cell activator, eosinophil granule major basic protein) , proteoglycan 2 |
| Synonyms | MBP BMPG proMBP |
| Synonyms name | eosinophil major basic protein |
| Locus | 11q12, 1 |
| Discovery year | 1993-09-29 |
| GenBank acession | BC005929 |
| Entrez gene record | 5553 |
| Pubmed identfication | 1565101 |
| RefSeq identity | NM_002728 |
| Classification | C-type lectin domain containing |
| Havana BLAST/BLAT | OTTHUMG00000167027 |