Name : Recombinant Human Bone Marrow Stromal Antigen 2, BST2, Tetherin, CD317 (C-6His)
Supplier : NOVO
Price :369
SKU : GEN3766021069
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 13, 67 kD |
| UniProt number | Q10589 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | BST2, CD317 (C-6His), Tetherin, Bone Marrow Stromal 2 |
| Short name | BST2, CD317 (C-6His), Tetherin, Recombinant Bone Marrow Stromal Antigen 2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD317 (C-6His), Tetherin, bone marrow stromal cell antigen 2, sapiens Bone Marrow Stromal protein 2, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BST2 and IDBG-36619 and ENSG00000130303 and 684, Bst2 and IDBG-165924 and ENSMUSG00000046718 and 69550, CD317 and TETHERIN, Cell surfaces, poly(A) RNA binding, this GO :0002737 and negative regulation of plasmacytoid dendritic cell cytokine production and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005770 and late endosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008191 and metalloendopeptidase inhibitor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030308 and negative regulation of cell growth and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0032956 and regulation of actin cytoskeleton organization and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0035455 and response to interferon-alpha and biological process this GO :0035456 and response to interferon-beta and biological process this GO :0042113 and B cell activation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0051607 and defense response to virus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :1901253 and negative regulation of intracellular transport of viral material and biological process, this GO :0004871: signal transducer activity, this GO :0004871: signal transducer activity and also this GO :0005515: protein binding and also this GO :0008191: metalloendopeptidase inhibitor activity and also this GO :0042803: protein homodimerization activity and also this GO :0044822: poly(A) RNA binding, this GO :0005515: protein binding, this GO :0008191: metalloendopeptidase inhibitor activity, this GO :0042803: protein homodimerization activity, this GO :0044822: poly(A) RNA binding, bone marrow stromal cell antigen 2 |
| Identity | 1119 |
| Gene | BST2 |
| Long gene name | bone marrow stromal cell antigen 2 |
| Synonyms | CD317 tetherin |
| Locus | 19p13, 11 |
| Discovery year | 1994-11-17 |
| Entrez gene record | 684 |
| Pubmed identfication | 7607676 |
| RefSeq identity | NM_004335 |
| Classification | CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000191770 |