Name : Recombinant Human Carbonic Anhydrase 10, CA10 (N-6His)
Supplier : NOVO
Price :1613
SKU : GEN1526786169
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Carbonic Anhydrase 10 is produced by our E, coli expression system and the target gene encoding Ala21-Asn300 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 1 kD, 34 |
| UniProt number | Q9NS85 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 25 mM Tris, 5, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MNHKVHHHHHHMAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNLELQSR |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CA10 (N-6His), Carbonic Anhydrase 10 |
| Short name | CA10 (N-6His), Recombinant Carbonic Anhydrase 10 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CA10 (N-6His), sapiens Carbonic Anhydrase 10, recombinant H |
| Alternative technique | rec |
| Identity | 1369 |
| Gene | CA10 |
| Long gene name | carbonic anhydrase 10 |
| Synonyms gene name | carbonic anhydrase X |
| Synonyms | CARPX CA-RPX HUCEP-15 |
| Locus | 17q21, 33-q22 |
| Discovery year | 1998-07-17 |
| GenBank acession | AF288385 |
| Entrez gene record | 56934 |
| Pubmed identfication | 8673298 9921901 |
| RefSeq identity | NM_020178 |
| Classification | Carbonic anhydrases |
| Havana BLAST/BLAT | OTTHUMG00000177544 |