Name : Recombinant Human Carbonic Anhydrase 3, CA3 (C-6His)
Supplier : NOVO
Price :339
SKU : GEN6163407083
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Carbonic Anhydrase 3 is produced by our E, coli expression system and the target gene encoding Ala2-Lys260 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 30, 6 kD |
| UniProt number | P07451 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM Tris, 5, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | AKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFKLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CA3 (C-6His), Carbonic Anhydrase 3 |
| Short name | CA3 (C-6His), Recombinant Carbonic Anhydrase 3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CA3 (C-6His), sapiens Carbonic Anhydrase 3, recombinant H |
| Alternative technique | rec |
| Identity | 1374 |
| Gene | CA3 |
| Long gene name | carbonic anhydrase 3 |
| Synonyms gene name | carbonic anhydrase III, muscle specific carbonic anhydrase III |
| Synonyms | Car3 CAIII |
| Locus | 8q21, 2 |
| Discovery year | 2001-06-22 |
| GenBank acession | AJ006473 |
| Entrez gene record | 761 |
| Pubmed identfication | 6221502 |
| RefSeq identity | NM_005181 |
| Classification | Carbonic anhydrases |
| Havana BLAST/BLAT | OTTHUMG00000164942 |