Name : Recombinant Human Chloride Intracellular Channel Protein 1, CLIC1 (N-6His)
Supplier : NOVO
Price :1613
SKU : GEN8840659473
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CLIC1 is produced by our E, coli expression system and the target gene encoding Met1-Lys241 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 29 kD |
| UniProt number | O00299 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CLIC1 (N-6His), Chloride Intracellular Channel Protein 1 |
| Short name | CLIC1 (N-6His), Recombinant Chloride Intracellular Channel Protein 1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CLIC1 (N-6His), sapiens Chloride Intracellular Channel Protein 1, recombinant H |
| Alternative technique | rec |
| Identity | 2062 |
| Gene | CLIC1 |
| Long gene name | chloride intracellular channel 1 |
| Synonyms | NCC27 p64CLCP G6 |
| Locus | 6p21, 33 |
| Discovery year | 1997-07-01 |
| GenBank acession | U93205 |
| Entrez gene record | 1192 |
| Pubmed identfication | 9139710 |
| RefSeq identity | NM_001288 |
| Classification | Chloride intracellular channels |
| Havana BLAST/BLAT | OTTHUMG00000031103 |