Name : Recombinant Human Chloride Intracellular Channel Protein 4, CLIC4 (N-6His)
Supplier : NOVO
Price :496
SKU : GEN4260634096
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human CLIC4 is produced by our E, coli expression system and the target gene encoding Met1-Lys253 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 30, 9 kD |
| UniProt number | Q9Y696 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 1 mM DTT, 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CLIC4 (N-6His), Chloride Intracellular Channel Protein 4 |
| Short name | CLIC4 (N-6His), Recombinant Chloride Intracellular Channel Protein 4 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CLIC4 (N-6His), sapiens Chloride Intracellular Channel Protein 4, recombinant H |
| Alternative technique | rec |
| Identity | 13518 |
| Gene | CLIC4 |
| Long gene name | chloride intracellular channel 4 |
| Synonyms | DKFZP566G223 CLIC4L P64H1 H1 huH1 p64H1 |
| Locus | 1p36, 11 |
| Discovery year | 2000-10-31 |
| GenBank acession | AF097330 |
| Entrez gene record | 25932 |
| Pubmed identfication | 9139710 10070163 |
| RefSeq identity | NM_013943 |
| Classification | Chloride intracellular channels |
| Havana BLAST/BLAT | OTTHUMG00000003327 |