Name : Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His)
Supplier : NOVO
Price :263
SKU : GEN4187916621
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are  |
| Molecular Weight | 24, 79 kD |
| UniProt number | Q96AP7 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | ESAM (C-6His), Endothelial Adhesion Molecule |
| Short name | ESAM (C-6His), Recombinant Endothelial Cell Adhesion Molecule |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | endothelial cell adhesion molecule (C-6His), sapiens Endothelial cellular Adhesion Molecule, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BT, Cell surfaces, ESAM and IDBG-75276 and ENSG00000149564 and 90952, Esam and IDBG-150411 and ENSMUSG00000001946 and 69524, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005912 and adherens junction and cellular component this GO :0005923 and tight junction and cellular component this GO :0007156 and homophilic cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding, 54007 and IDBG-642621 and ENSBTAG00000001004 and 616926, endothelial cell adhesion molecule |
| Identity | 17474 |
| Gene | ESAM |
| Long gene name | endothelial cell adhesion molecule |
| Synonyms | W117m |
| Locus | 11q24, 2 |
| Discovery year | 2003-11-26 |
| GenBank acession | AK075396 |
| Entrez gene record | 90952 |
| Pubmed identfication | 11279107 11906820 |
| RefSeq identity | NM_138961 |
| Classification | Immunoglobulin like domain containing V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000151986 |