Name : Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-Fc)
Supplier : NOVO
Price :146
SKU : GEN5360259147
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are  |
| Molecular Weight | 50, 8 kD |
| UniProt number | Q96AP7 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | ESAM (C-Fc), Endothelial Adhesion Molecule |
| Short name | ESAM (C-Fc), Recombinant Endothelial Cell Adhesion Molecule |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | endothelial cell adhesion molecule (C-fragment c), sapiens Endothelial cellular Adhesion Molecule, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BT, Cell surfaces, ESAM and IDBG-75276 and ENSG00000149564 and 90952, Esam and IDBG-150411 and ENSMUSG00000001946 and 69524, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005912 and adherens junction and cellular component this GO :0005923 and tight junction and cellular component this GO :0007156 and homophilic cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding, 54007 and IDBG-642621 and ENSBTAG00000001004 and 616926, endothelial cell adhesion molecule |
| Identity | 17474 |
| Gene | ESAM |
| Long gene name | endothelial cell adhesion molecule |
| Synonyms | W117m |
| Locus | 11q24, 2 |
| Discovery year | 2003-11-26 |
| GenBank acession | AK075396 |
| Entrez gene record | 90952 |
| Pubmed identfication | 11279107 11906820 |
| RefSeq identity | NM_138961 |
| Classification | Immunoglobulin like domain containing V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000151986 |