Name : Recombinant Human Heat Shock Protein β-11, HSPB11 (N-6His)
Supplier : NOVO
Price :1613
SKU : GEN9784749688
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Heat Shock Protein beta-11 is produced by our E, coli expression system and the target gene encoding Met1-Ser144 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 18, 5 kD |
| UniProt number | Q9Y547 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 10% Glycerol, 100 mM sodium chloride, 2 mM DTT, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | HSPB11 (N-6His), -11, Heat Shock Protein &beta |
| Short name | HSPB11 (N-6His), -11, Recombinant Heat Shock Protein &beta |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | heat shock protein family B (small), member 11 (N-6His), sapiens Heat Shock Protein &beta, -11, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | C3H1ORF41 and IDBG-639177 and ENSBTAG00000007112 and 616194, HSPB11 and IDBG-98847 and ENSG00000081870 and 51668, Hspb11 and IDBG-171460 and ENSMUSG00000063172 and 72938, member 11, metal ion binding, multiple, this GO :0001501 and skeletal system development and biological process this GO :0005813 and centrosome and cellular component this GO :0005929 and cilium and cellular component this GO :0006950 and response to stress and biological process this GO :0007155 and cell adhesion and biological process this GO :0007224 and smoothened signaling pathway and biological process this GO :0007507 and heart development and biological process this GO :0015031 and protein transport and biological process this GO :0030324 and lung development and biological process this GO :0030992 and intraciliary transport particle B and cellular component this GO :0046872 and metal ion binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070986 and left/right axis specification and biological process, this GO :0046872: metal ion binding, this GO :0046872: metal ion binding, heat shock protein family B (small) |
| Identity | 25019 |
| Gene | HSPB11 |
| Long gene name | heat shock protein family B (small) member 11 |
| Synonyms gene | C1orf41 |
| Synonyms gene name | chromosome 1 open reading frame 41 heat shock protein family B (small), member 11 |
| Synonyms | HSPCO34 PP25 IFT25 |
| Synonyms name | intraflagellar transport 25 homolog (Chlamydomonas) |
| Locus | 1p32, 3 |
| Discovery year | 2004-06-24 |
| GenBank acession | AF100747 |
| Entrez gene record | 51668 |
| Pubmed identfication | 11042152 19253336 |
| RefSeq identity | NM_016126 |
| Classification | Intraflagellar transport proteins Small heat shock proteins |
| Havana BLAST/BLAT | OTTHUMG00000008408 |