Name : Recombinant Human Heat Shock Protein β-8, , HSPB8 (C-6His)
Supplier : NOVO
Price :496
SKU : GEN3488028049
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Heat shock protein beta-8 is produced by our E, coli expression system and the target gene encoding Met1-Thr196 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 22, 7 kD |
| UniProt number | Q9UJY1 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCTLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | HSPB8 (C-6His), -8, Heat Shock Protein &beta |
| Short name | HSPB8 (C-6His), -8, Recombinant Heat Shock Protein &beta |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | , HSPB8 (C-6His), sapiens Heat Shock Protein &beta, -8, recombinant H |
| Alternative technique | rec |
| Identity | 30171 |
| Gene | HSPB8 |
| Long gene name | heat shock protein family B (small) member 8 |
| Synonyms gene name | heat shock 27kDa protein 8 heat shock 22kDa protein 8 |
| Synonyms | H11 E2IG1 HSP22 HspB8 CMT2L |
| Locus | 12q24, 23 |
| Discovery year | 2004-01-29 |
| GenBank acession | AF191017 |
| Entrez gene record | 26353 |
| Pubmed identfication | 10833516 11085516 |
| RefSeq identity | NM_014365 |
| Classification | Small heat shock proteins |
| Havana BLAST/BLAT | OTTHUMG00000168932 |
| Locus Specific Databases | Inherited Peripheral Neuropathies Mutation Database LRG_249 |