Filters

Recombinant Human S100 Calcium Binding Protein A8, A9 Heterodimer (C-6His)

Recombinant Human S100 Calcium Binding Protein A8, A9 Heterodimer (C-6His) size: 1 mg 2283

Supplier NOVO
Price 2283
Size 1 mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
Reacts withHuman
Source proteins, Recombinants or rec
Description S100A9 Heterodimer is produced by our E, Recombinant Human S100A8 &, Thr2-Pro114(S100A9) is expressed with a 6His tag at the C-terminus, coli expression system and the target gene encoding Met1-Glu93(S100A8)&
Molecular Weight11, 13, 2 kD, 7&
UniProt number P06702, P05109 &
State of the productLiquid
Shipping conditionsDry ice/ice packs
Formulation10%Glycerol, 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM HEPES, 4, 5 mM EDTA, Supplied as a 0, pH 7
Storage recommendations -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acidMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH&, TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Levels of endotoxin11 IEU/ug, LAL test shows less than than 0
Properties Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Grouprecombinants
Gene target A9 Heterodimer (C-6His), S100 Calcium Binding Protein A8
Short name A9 Heterodimer (C-6His), Recombinant S100 Calcium Binding Protein A8
Technique E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species Humans, Human
Alternative name A9 Heterodimer (C-6His), sapiens S100 Calcium Binding Protein A8, recombinant H
Alternative techniquerec

Similar products

Subscribe to our Newsletter