| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Interleukin-36 beta is produced by our E, coli expression system and the target gene encoding Ser31-Lys183 is expressed |
| Molecular Weight | 17, 6 kD |
| UniProt number | Q9D6Z6 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 1 mM EDTA, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH 8 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | IL-36b, IL1F8, Interleukin-36b |
| Short name | IL-36b, IL1F8, Recombinant Mouse Interleukin-36b |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | IL1F8, Interleukin-36b, recombinant Mouse Interleukin-36b |
| Alternative technique | rec |
| Identity | 15564 |
| Gene | IL36B |
| Long gene name | beta , interleukin 36 |
| Synonyms gene | IL1F8 |
| Synonyms gene name | interleukin 1 family, member 8 (eta) |
| Synonyms | FIL1 IL-1H2 IL-1F8 FILI-(ETA) IL1-ETA IL1H2 MGC126880 MGC126882 |
| Locus | 2q14, 1 |
| Discovery year | 2002-08-02 |
| GenBank acession | AF201833 |
| Entrez gene record | 27177 |
| Pubmed identfication | 10625660 10512743 16646978 |
| RefSeq identity | NM_014438 |
| Classification | Interleukins |
| Havana BLAST/BLAT | OTTHUMG00000131338 |