Specificity Protein 1 Antibody / SP1

Specificity Protein 1 Antibody / SP1 size: 0.1mg 406

Price 406

Size 0.1mg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Category	Antibody
Concentration	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form	Antigen affinity purified
Conjugation	Unconjugated
Clone	Polyclonal antibody
Recognised antigen	Specificity Protein 1 / SP1
Host animal	Rabbit (Oryctolagus cuniculus)
Clonality	Polyclonal (rabbit origin)
Species reactivity	Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications	WB
Recommended dilutions	1-0, 5ug/ml, Western blot: 0
Notes	Optimal dilution of the SP1 antibody should be determined by the researcher
Intented use	This SP1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #	P08047
Purity	Antigen affinity
Description	(1993) concluded that 12q13, (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1, By fluorescence in situ hybridization, By in situ hybridization, Gaynor et al, It belongs to the Sp/KLF family of transcription factors, Matera and Ward (1993) mapped the SP1 gene to 12q13, Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm, The formation of 7 head segments depends on the function of several genes, The protein is 785 amino acids long, Wimmer et al, also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism, with a molecular weight of 81 kDA, 1 is the most probable location of the SP1 gene, SP1 (transcription factor Sp1)
Immunogen	Amino acids EAICPEGIARLANSGINVMQVADLQSINISGNGF of human SP1 were used as the immunogen for the SP1 antibody
Storage	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target	Protein 1 / SP1
Short name	Protein 1 Antibody / SP1
Technique	antibodies against human proteins, antibodies for, Antibody
Alternative name	Specificity Protein 1 (Antibody to) / SP1
Alternative technique	antibodies
Identity	11205
Gene	SP1
Long gene name	Sp1 transcription factor
Synonyms name	specificity protein 1
Locus	12q13, 13
Discovery year	1991-06-04
GenBank acession	J03133
Entrez gene record	6667
Pubmed identfication	1662663
Classification	Sp transcription factors Zinc fingers C2H2-type
Havana BLAST/BLAT	OTTHUMG00000170047

Specificity Protein 1 Antibody / SP1

Specificity Protein 1 Antibody / SP1 size: 0.1mg 406

Similar products

Subscribe to our Newsletter