| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Interleukin-3 is produced by our Mammalian expression system and the target gene encoding Ala20-Phe152 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 16 |
| UniProt number | P08700 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | IL-3 (C-6His), Interleukin-3 |
| Short name | IL-3 (C-6His), Recombinant Interleukin-3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | Interleukin-3 (C-6His), sapiens Interleukin-3, recombinant H |
| Alternative technique | rec |
| Identity | 6011 |
| Gene | IL3 |
| Long gene name | interleukin 3 |
| Synonyms gene name | interleukin 3 (colony-stimulating factor, multiple) |
| Synonyms | IL-3 MULTI-CSF MCGF MGC79398 MGC79399 |
| Synonyms name | multilineage-colony-stimulating factor hematopoietic growth factor P-cell stimulating factor mast-cell growth factor colony-stimulating factor, multiple |
| Locus | 5q31, 1 |
| Discovery year | 2001-06-22 |
| GenBank acession | M14743 |
| Entrez gene record | 3562 |
| Pubmed identfication | 3489530 |
| RefSeq identity | NM_000588 |
| Classification | Interleukins |
| Havana BLAST/BLAT | OTTHUMG00000059640 |