Technique
Supplier
Species
Label
Iso Type
Host
Tissue
Recombinant Human Interleukin-36γ, IL-36γ, IL-1F9
Recombinant Human Interleukin-36γ, IL-36γ, IL-1F9 size: 1 mg 2486
Supplier
NOVO
Price
2486
Size
1 mg
Contact us
Ask Component cell markers and DNA bp. markers are genetic markerser genes
or DNA sequenceswith
selection audit
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Interleukin-36 gamma is produced by our E, coli expression system and the target gene encoding Ser18-Asp169 is expressed |
| Molecular Weight | 17 kD |
| UniProt number | Q9NZH8 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 1 mM EDTA, 100 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | IL-1F9, IL-36&gamma, Interleukin-36&gamma |
| Short name | IL-1F9, IL-36&gamma, Recombinant Interleukin-36&gamma |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | Interleukin-1F9, Interleukin-36&gamma, sapiens Interleukin-36&gamma, recombinant H |
| Alternative technique | rec |
| Identity | 15741 |
| Gene | IL36G |
| Long gene name | gamma , interleukin 36 |
| Synonyms gene | IL1F9 |
| Synonyms gene name | interleukin 1 family, member 9 |
| Synonyms | IL-1H1 IL-1RP2 IL-1F9 IL1H1 IL1E |
| Synonyms name | interleukin-1 homolog 1 interleukin 1-related protein 2 interleukin-1 epsilon |
| Locus | 2q14, 1 |
| Discovery year | 2002-08-02 |
| GenBank acession | AF200492 |
| Entrez gene record | 56300 |
| Pubmed identfication | 10860666 10744718 11991722 11991723 |
| RefSeq identity | NM_019618 |
| Classification | Interleukins |
| Havana BLAST/BLAT | OTTHUMG00000131336 |
Similar products
- LIMITED QTY-rhIL-2 Recombinant Human Interleukin-2
- rhIL-2 Recombinant Human Interleukin-2
- LIMITED QTY-rhIL-2 Recombinant Human Interleukin-2
- Recombinant Human Interleukin-11, IL-11
- Recombinant Human Interleukin-11, IL-11
- Recombinant Human Interleukin-11, IL-11
- Recombinant Human Interleukin-11, IL-11
- Recombinant Human Interleukin-6, IL-6
- Recombinant Human Interleukin-6, IL-6
- Recombinant Human Interleukin-6, IL-6
- Recombinant Human Interleukin-6, IL-6
- Recombinant Human Interleukin-2, IL-2
- Recombinant Human Interleukin-2, IL-2
- Recombinant Human Interleukin-2, IL-2
- Recombinant Human Interleukin-2, IL-2
- Recombinant Human Interleukin-15, IL-15
- Recombinant Human Interleukin-15, IL-15
- Recombinant Human Interleukin-15, IL-15
- Recombinant Human Interleukin-15, IL-15
- Recombinant Human Interleukin-17A, IL-17A
- Recombinant Human Interleukin-17A, IL-17A
- Recombinant Human Interleukin-17A, IL-17A
- Recombinant Human Interleukin-17A, IL-17A
- Recombinant Human Interleukin-10, IL-10 (N-6His)
- Recombinant Human Interleukin-10, IL-10 (N-6His)
- Recombinant Human Interleukin-10, IL-10 (N-6His)
- Recombinant Human Interleukin-10, IL-10 (N-6His)
- Recombinant Human Interleukin-17F, IL-17F
- Recombinant Human Interleukin-17F, IL-17F
- Recombinant Human Interleukin-17F, IL-17F
- Recombinant Human Interleukin-17F, IL-17F
- Recombinant Human Interleukin-8, IL-8 (Ser28-Ser99)
- Recombinant Human Interleukin-8, IL-8 (Ser28-Ser99)
- Recombinant Human Interleukin-8, IL-8 (Ser28-Ser99)
- Recombinant Human Interleukin-8, IL-8 (Ser28-Ser99)
- Recombinant Human Interleukin-8, IL-8 (Ala23-Ser99)
- Recombinant Human Interleukin-8, IL-8 (Ala23-Ser99)
- Recombinant Human Interleukin-8, IL-8 (Ala23-Ser99)
- Recombinant Human Interleukin-8, IL-8 (Ala23-Ser99)
- Recombinant Human Interleukin-16, IL-16
- Recombinant Human Interleukin-16, IL-16
- Recombinant Human Interleukin-16, IL-16
- Recombinant Human Interleukin-16, IL-16
- Recombinant Human Interleukin-4, IL-4 (E. coli)
- Recombinant Human Interleukin-4, IL-4 (E. coli)
- Recombinant Human Interleukin-4, IL-4 (E. coli)
- Recombinant Human Interleukin-4, IL-4 (E. coli)
- Recombinant Human Interleukin-31, IL-31
- Recombinant Human Interleukin-31, IL-31
- Recombinant Human Interleukin-31, IL-31
- Recombinant Human Interleukin-31, IL-31
- Recombinant Human Interleukin-1α, IL-1α
- Recombinant Human Interleukin-1α, IL-1α
- Recombinant Human Interleukin-1α, IL-1α
- Recombinant Human Interleukin-1α, IL-1α
- Recombinant Human Interleukin-36α, IL-36α
- Recombinant Human Interleukin-36α, IL-36α
- Recombinant Human Interleukin-36α, IL-36α
- Recombinant Human Interleukin-36α, IL-36α
- Recombinant Human Interleukin-37, IL-37
- Recombinant Human Interleukin-37, IL-37
- Recombinant Human Interleukin-37, IL-37
- Recombinant Human Interleukin-37, IL-37
- Recombinant Human Interleukin-38, IL-38, IL-1F10
- Recombinant Human Interleukin-38, IL-38, IL-1F10
- Recombinant Human Interleukin-38, IL-38, IL-1F10
- Recombinant Human Interleukin-38, IL-38, IL-1F10
- Recombinant Human Interleukin-7, IL-7
- Recombinant Human Interleukin-7, IL-7
- Recombinant Human Interleukin-7, IL-7
- Recombinant Human Interleukin-7, IL-7
- Recombinant Human Interleukin-33, IL-33
- Recombinant Human Interleukin-33, IL-33
- Recombinant Human Interleukin-33, IL-33
- Recombinant Human Interleukin-33, IL-33
- Recombinant Human Interleukin-20, IL-20
- Recombinant Human Interleukin-20, IL-20
- Recombinant Human Interleukin-20, IL-20
- Recombinant Human Interleukin-20, IL-20
- Recombinant Human Interleukin-33, IL-33 (N-6His)
- Recombinant Human Interleukin-33, IL-33 (N-6His)
- Recombinant Human Interleukin-33, IL-33 (N-6His)
- Recombinant Human Interleukin-33, IL-33 (N-6His)
- Recombinant Human Interleukin-17A, IL-17A (C-6His)
- Recombinant Human Interleukin-17A, IL-17A (C-6His)
- Recombinant Human Interleukin-17A, IL-17A (C-6His)
- Recombinant Human Interleukin-17A, IL-17A (C-6His)
- Recombinant Human Interleukin-25, IL-25 (C-6His)
- Recombinant Human Interleukin-25, IL-25 (C-6His)
- Recombinant Human Interleukin-25, IL-25 (C-6His)
- Recombinant Human Interleukin-25, IL-25 (C-6His)
- Recombinant Human Interleukin-9, IL-9, Cytokine P40 (C-6His)
- Recombinant Human Interleukin-9, IL-9, Cytokine P40 (C-6His)
- Recombinant Human Interleukin-9, IL-9, Cytokine P40 (C-6His)
- Recombinant Human Interleukin-9, IL-9, Cytokine P40 (C-6His)
- Recombinant Human Interleukin-17F, IL-17F (C-6His)
- Recombinant Human Interleukin-17F, IL-17F (C-6His)
- Recombinant Human Interleukin-17F, IL-17F (C-6His)
- Recombinant Human Interleukin-17F, IL-17F (C-6His)
- Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 (C-6His)
- Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 (C-6His)
- Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3 (C-6His)
- Recombinant Human Interleukin-27, IL-27 (C-6His)
- Recombinant Human Interleukin-27, IL-27 (C-6His)
- Recombinant Human Interleukin-27, IL-27 (C-6His)
- Recombinant Human Interleukin-27, IL-27 (C-6His)
- Recombinant Human Interleukin-17B, IL-17B (C-Fc)
- Recombinant Human Interleukin-17B, IL-17B (C-Fc)
- Recombinant Human Interleukin-17B, IL-17B (C-Fc)
- Recombinant Human Interleukin-17B, IL-17B (C-Fc)
- Recombinant Human Interleukin-18-Binding Protein, IL18BP (C-Fc)
- Recombinant Human Interleukin-18-Binding Protein, IL18BP (C-Fc)
- Recombinant Human Interleukin-18-Binding Protein, IL18BP (C-Fc)
- Recombinant Human Interleukin-18-Binding Protein, IL18BP (C-Fc)
- Recombinant Human Interleukin-21, IL-21
- Recombinant Human Interleukin-21, IL-21
- Recombinant Human Interleukin-21, IL-21
- Recombinant Human Interleukin-21, IL-21
- Recombinant Human Interleukin-13, IL-13 (C-6His)
- Recombinant Human Interleukin-13, IL-13 (C-6His)
- Recombinant Human Interleukin-13, IL-13 (C-6His)
- Recombinant Human Interleukin-13, IL-13 (C-6His)
- Recombinant Human Interleukin-8, IL-8 (C-6His)
- Recombinant Human Interleukin-8, IL-8 (C-6His)
- Recombinant Human Interleukin-8, IL-8 (C-6His)
- Recombinant Human Interleukin-8, IL-8 (C-6His)
- Recombinant Human Interleukin-4, IL-4 (Human Cells)
- Recombinant Human Interleukin-4, IL-4 (Human Cells)
- Recombinant Human Interleukin-4, IL-4 (Human Cells)
- Recombinant Human Interleukin-4, IL-4 (Human Cells)
- Recombinant Human Interleukin-10, IL-10
- Recombinant Human Interleukin-10, IL-10
- Recombinant Human Interleukin-10, IL-10
- Recombinant Human Interleukin-10, IL-10
- Recombinant Human Interleukin-7, IL-7 (C-6His)
- Recombinant Human Interleukin-7, IL-7 (C-6His)
- Recombinant Human Interleukin-7, IL-7 (C-6His)
- Recombinant Human Interleukin-7, IL-7 (C-6His)
- Recombinant Human Interleukin-2, IL-2 (C-6His)
- Recombinant Human Interleukin-2, IL-2 (C-6His)
- Recombinant Human Interleukin-2, IL-2 (C-6His)
- Recombinant Human Interleukin-2, IL-2 (C-6His)
- Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His)
- Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His)
- Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His)
- Recombinant Human Interleukin-18, IL-18, IL-1F4 (C-6His)
- Recombinant Human Interleukin-4, IL-4 (C-6His)
- Recombinant Human Interleukin-4, IL-4 (C-6His)
- Recombinant Human Interleukin-4, IL-4 (C-6His)
- Recombinant Human Interleukin-4, IL-4 (C-6His)
- Recombinant Human Interleukin-3, IL-3 (C-6His)
- Recombinant Human Interleukin-3, IL-3 (C-6His)
- Recombinant Human Interleukin-3, IL-3 (C-6His)
- Recombinant Human Interleukin-3, IL-3 (C-6His)
- Recombinant Human Interleukin-3, IL-3 (N-6His)
- Recombinant Human Interleukin-3, IL-3 (N-6His)
- Recombinant Human Interleukin-3, IL-3 (N-6His)
- Recombinant Human Interleukin-3, IL-3 (N-6His)
- Recombinant Human Interleukin-25, IL25, MYDGF (N-6His)
- Recombinant Human Interleukin-25, IL25, MYDGF (N-6His)
- Recombinant Human Interleukin-25, IL25, MYDGF (N-6His)
- Recombinant Human Interleukin-25, IL25, MYDGF (N-6His)
- Recombinant Human Interleukin-1β, IL-1β
- Recombinant Human Interleukin-1β, IL-1β
- Recombinant Human Interleukin-1β, IL-1β
- Recombinant Human Interleukin-1β, IL-1β
- Recombinant Human Interleukin-17D, IL-17D
- Recombinant Human Interleukin-17D, IL-17D
- Recombinant Human Interleukin-17D, IL-17D
- Recombinant Human Interleukin-18, IL-18, IL-1F4
- Recombinant Human Interleukin-18, IL-18, IL-1F4
- Recombinant Human Interleukin-18, IL-18, IL-1F4
- Recombinant Human Interleukin-18, IL-18, IL-1F4
- Recombinant Human Interleukin-22, IL-22
- Recombinant Human Interleukin-22, IL-22
- Recombinant Human Interleukin-22, IL-22
- Recombinant Human Interleukin-22, IL-22
- Recombinant Human Interleukin-12 , IL-12
- Recombinant Human Interleukin-12 , IL-12
- Recombinant Human Interleukin-12 , IL-12
- Recombinant Human Interleukin-12 , IL-12
- Recombinant Human Interleukin-5, IL-5 (C-6His)
- Recombinant Human Interleukin-5, IL-5 (C-6His)
- Recombinant Human Interleukin-5, IL-5 (C-6His)
- Recombinant Human Interleukin-5, IL-5 (C-6His)
- Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His)
- Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His)
- Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His)
- Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His)
- Recombinant Human Interleukin-12 Subunit β, IL-12 p40, IL-12B
- Recombinant Human Interleukin-12 Subunit β, IL-12 p40, IL-12B
- Recombinant Human Interleukin-12 Subunit β, IL-12 p40, IL-12B
- Recombinant Human Interleukin-12 Subunit β, IL-12 p40, IL-12B
- Recombinant Human Interleukin-23, IL-23 (C-6His)
- Recombinant Human Interleukin-23, IL-23 (C-6His)
- Recombinant Human Interleukin-23, IL-23 (C-6His)
- Recombinant Human Interleukin-23, IL-23 (C-6His)
- Recombinant Human Interleukin-17B, IL-17B (C-6His)
- Recombinant Human Interleukin-17B, IL-17B (C-6His)
- Recombinant Human Interleukin-17B, IL-17B (C-6His)
- Recombinant Human Interleukin-17B, IL-17B (C-6His)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG2 Fc)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG2 Fc)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG2 Fc)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG2 Fc)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG4 Fc)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG4 Fc)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG4 Fc)
- Recombinant Human Interleukin-22, IL-22 (C-hIgG4 Fc)
- Recombinant Human Interleukin-36γ, IL-36γ, IL-1F9
- Recombinant Human Interleukin-36γ, IL-36γ, IL-1F9
- Recombinant Human Interleukin-36γ, IL-36γ, IL-1F9
- Recombinant Human Interleukin-36γ, IL-36γ, IL-1F9
- Recombinant Human Interleukin-35, IL-35 (C-Fc)
- Recombinant Human Interleukin-35, IL-35 (C-Fc)
- Recombinant Human Interleukin-35, IL-35 (C-Fc)
- Recombinant Human Interleukin-35, IL-35 (C-Fc)
- Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3
- Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3
- Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3
- Recombinant Human Interleukin-28B, IL-28B, IFN-lambda 3
- Recombinant Human Interleukin-17F, IL-17F (Human Cells)
- Recombinant Human Interleukin-17F, IL-17F (Human Cells)
- Recombinant Human Interleukin-17F, IL-17F (Human Cells)
- Recombinant Human Interleukin-17F, IL-17F (Human Cells)
- Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His)
- Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His)
- Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His)
- Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-6His)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-6His)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-6His)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-6His)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-Fc)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-Fc)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-Fc)
- Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-Fc)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-Fc)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-Fc)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-Fc)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-Fc)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-6His)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-6His)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-6His)
- Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-6His)
- Recombinant Human Interleukin-21 / IL-21 Protein
- Recombinant Human Interleukin-1 alpha(IL-1α) Protein
- Recombinant Human Interleukin-2(IL-2) Protein
- Recombinant Human Interleukin-2(IL-2) Protein
- Recombinant Human Interleukin-3(IL-3) Protein
- Recombinant Human Interleukin-4(IL-4) Protein
- Recombinant Human Interleukin-4(IL-4) Protein
- Recombinant Human Interleukin-6(IL-6) Protein
- Recombinant Human Interleukin-18(IL-18) Protein
- Recombinant Human Interleukin-29
- Recombinant Human Interleukin-13 Variant
- Recombinant Human Interleukin-16 His Tag
- Recombinant Human Interleukin-17E
- recombinant HUMAN INTERLEUKIN-22
- Recombinant Human Interleukin-3 Yeast
- Recombinant Human Interleukin-17F
- recombinant HUMAN INTERLEUKIN-4
- Recombinant Human Interleukin-2 His Tag
- Recombinant Human Interleukin-18 His Tag
- Recombinant Human Interleukin-1 Receptor Like-1
- Recombinant Human Interleukin-17A His Tag
- Recombinant Human Interleukin-17 A/F Heterodimer
- recombinant HUMAN INTERLEUKIN-4
- Recombinant Human Interleukin-28A
- Recombinant Human Interleukin-2 Yeast
- Recombinant Human Interleukin-31