Name : Recombinant Human SLAM Family Member 2, CD48 (C-Fc-6His)
Supplier : NOVO
Price :146
SKU : GEN3086172723
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | 6His tag at the C-terminus, Recombinant Human SLAMF2 is produced by our Mammalian expression system and the target gene encoding Gln27-Ser220 is expressed with a Fc |
| Molecular Weight | 1 kD, 53 |
| UniProt number | P09326 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD48 (C-Fc-6His), SLAM Family Member 2 |
| Short name | CD48 (C-Fc-6His), Recombinant SLAM Family Member 2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD48 molecule (C-fragment c-6His), sapiens SLAM family Member 2, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BCM1 and BLAST and BLAST1 and hCD48 and mCD48 and MEM-102 and SLAMF2, CD48 and IDBG-104080 and ENSG00000117091 and 962, CD48 and IDBG-630526 and ENSBTAG00000011238 and 508386, Cd48 and IDBG-204791 and ENSMUSG00000015355 and 12506, Cell surfaces, protein binding, this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042110 and T cell activation and biological process this GO :0043234 and protein complex and cellular component this GO :0045121 and membrane raft and cellular component this GO :0045576 and mast cell activation and biological process this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003823: antigen binding, this GO :0003823: antigen binding and also this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0004872: receptor activity, this GO :0005515: protein binding, CD48 molecule |
| Identity | 1683 |
| Gene | CD48 |
| Long gene name | CD48 molecule |
| Synonyms gene | BCM1 |
| Synonyms gene name | CD48 antigen (B-cell membrane protein) CD48 molecule |
| Synonyms | BLAST mCD48 hCD48 SLAMF2 |
| Locus | 1q23, 3 |
| Discovery year | 1986-01-01 |
| GenBank acession | BC016182 |
| Entrez gene record | 962 |
| Pubmed identfication | 2828034 |
| RefSeq identity | NM_001778 |
| Classification | Immunoglobulin like domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000024009 |