Name : Recombinant Human SLAM Family Member 6, SLAMF6, CD352, NTB-A (C-Fc)
Supplier : NOVO
Price :141
SKU : GEN5837467592
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human SLAM Family Member 6 is produced by our Mammalian expression system and the target gene encoding Gln22-Lys225 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 49, 6 kD |
| UniProt number | Q96DU3 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD352, NTB-A (C-Fc), SLAMF6, SLAM Family Member 6 |
| Short name | CD352, NTB-A (C-Fc), SLAMF6, Recombinant SLAM Family Member 6 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD352, NTB-A (C-fragment c), SLAMF6, sapiens SLAM family Member 6, recombinant H |
| Alternative technique | rec |
| Identity | 21392 |
| Gene | SLAMF6 |
| Long gene name | SLAM family member 6 |
| Synonyms | KALI NTBA KALIb Ly108 SF2000 NTB-A CD352 |
| Locus | 1q23, 2-q23, 3 |
| Discovery year | 2003-10-29 |
| GenBank acession | AL832854 |
| Entrez gene record | 114836 |
| Pubmed identfication | 11489943 |
| RefSeq identity | NM_052931 |
| Classification | CD molecules V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT | OTTHUMG00000022729 |