Name : Recombinant Human SLAM Family Member 7, SLAMF7, CD319, CRACC (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN7835148921
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human SLAMF7 is produced by our Mammalian expression system and the target gene encoding Ser23-Ser225 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 23, 3 kD |
| UniProt number | Q9NQ25 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD319, CRACC (C-6His), SLAMF7, SLAM Family Member 7 |
| Short name | CD319, CRACC (C-6His), SLAMF7, Recombinant SLAM Family Member 7 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD319, CRACC (C-6His), SLAM family member 7, sapiens SLAM family Member 7, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Cell surfaces, SLAMF7 and IDBG-104088 and ENSG00000026751 and 57823, SLAMF7 and IDBG-630522 and ENSBTAG00000001197 and 790164, Slamf7 and IDBG-204760 and ENSMUSG00000038179 and 75345, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030101 and natural killer cell activation and biological process this GO :0032814 and regulation of natural killer cell activation and biological process this GO :0042267 and natural killer cell mediated cytotoxicity and biological process this GO :0045087 and innate immune response and biological process, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, SLAM family member 7 |
| Identity | 21394 |
| Gene | SLAMF7 |
| Long gene name | SLAM family member 7 |
| Synonyms | CRACC 19A CS1 CD319 |
| Locus | 1q23, 3 |
| Discovery year | 2003-10-29 |
| GenBank acession | AB027233 |
| Entrez gene record | 57823 |
| Pubmed identfication | 11802771 11220635 |
| RefSeq identity | NM_021181 |
| Classification | CD molecules V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000024008 |