Name : Recombinant Human SLAM Family Member 5, SLAMF5, CD84(C-6His)
Supplier : NOVO
Price :1674
SKU : GEN6817796302
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human SLAM Family Member 5 is produced by our Mammalian expression system and the target gene encoding Lys22-Arg220 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 23 |
| UniProt number | Q9UIB8 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD84(C-6His), SLAMF5, SLAM Family Member 5 |
| Short name | CD84(C-6His), SLAMF5, Recombinant SLAM Family Member 5 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD84 molecule(C-6His), SLAMF5, sapiens SLAM family Member 5, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD84 and IDBG-104060 and ENSG00000066294 and 8832, CD84 and IDBG-630532 and ENSBTAG00000019033 and, Cd84 and IDBG-204869 and ENSMUSG00000038147 and 12523, Plasma membranes, hCD84 and LY9B and mCD84 and SLAMF5, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0007156 and homophilic cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, CD84 molecule |
| Identity | 1704 |
| Gene | CD84 |
| Long gene name | CD84 molecule |
| Synonyms gene name | CD84 antigen (leukocyte antigen) CD84 molecule |
| Synonyms | SLAMF5 hCD84 mCD84 |
| Locus | 1q23, 3 |
| Discovery year | 1999-01-18 |
| GenBank acession | AF054816 |
| Entrez gene record | 8832 |
| Pubmed identfication | 9310491 |
| RefSeq identity | NM_003874 |
| Classification | Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000022788 |