Filters

APC2 Antibody

APC2 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenAPC2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis APC2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O95996
PurityAntigen affinity
Description A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool, The human APC2 gene is mapped to chromosome 19p13, also called APCL or Adenomatous polyposis coli protein-like, although less efficiently than APC, followed by an armadillo domain and five 20-amino acid repeats, is a deduced 2, 3, 303-amino acid protein that contains an N-terminal coiled-coil domain, APC2
ImmunogenAmino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the APC2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetAPC2
Short nameAPC2 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameAPC2 (Antibody to)
Alternative techniqueantibodies
Identity 24036
Gene APC2
Long gene name APC2, WNT signaling pathway regulator
Synonyms gene name adenomatosis polyposis coli 2
Synonyms APCL
Synonyms name adenomatous polyposis coli like
Locus 19p13, 3
Discovery year 2004-03-18
Entrez gene record 10297
Pubmed identfication 9823329 10021369
RefSeq identity NM_005883
Classification Armadillo repeat containing
Havana BLAST/BLAT OTTHUMG00000180059

Similar products

Subscribe to our Newsletter