| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 62 kD, 8 |
| UniProt number | P22362 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CCL1, C-C Motif Chemokine 1 |
| Short name | CCL1, Recombinant C-C Motif Chemokine 1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | chemokine (C-C motif) ligand 1, sapiens C-C Motif Chemokine 1, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CCL1 and IDBG-40784 and ENSG00000108702 and 6346, CCL1 and IDBG-630939 and ENSBTAG00000008832 and 786156, Ccl1 and IDBG-204562 and ENSMUSG00000020702 and 20290, Extracellular, I-309 and P500 and SCYA1 and SISe and TCA3, chemokine activity, this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008009 and chemokine activity and molecular function this GO :0016032 and viral process and biological process this GO :0045087 and innate immune response and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity and also this GO :0005515: protein binding and also this GO :0008009: chemokine activity, this GO :0005515: protein binding, this GO :0008009: chemokine activity, 786204, chemokine (C-C motif) ligand 1 |
| Identity | 10609 |
| Gene | CCL1 |
| Long gene name | C-C motif chemokine ligand 1 |
| Synonyms gene | SCYA1 |
| Synonyms gene name | homologous to mouse Tca-3) chemokine (C-C motif) ligand 1 , small inducible cytokine A1 (I-309 |
| Synonyms | I-309 TCA3 P500 SISe |
| Synonyms name | inflammatory cytokine I-309 T lymphocyte-secreted protein I-309 |
| Locus | 17q12 |
| Discovery year | 1990-07-05 |
| GenBank acession | M57506 |
| Entrez gene record | 6346 |
| Pubmed identfication | 2212659 10409433 |
| RefSeq identity | NM_002981 |
| Classification | Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000132888 |