| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 5 kD, 7 |
| UniProt number | P10147 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CCL3, C-C Motif Chemokine 3 |
| Short name | CCL3, Recombinant C-C Motif Chemokine 3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | chemokine (C-C motif) ligand 3, sapiens C-C Motif Chemokine 3, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CCL3 and IDBG-776925 and ENSG00000277632 and 6348, Extracellular, G0S19-1 and LD78ALPHA and MIP-1-alpha and MIP1A and SCYA3, identical protein binding, this GO :0000165 and MAPK cascade and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001775 and cell activation and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004698 and calcium-dependent protein kinase C activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006887 and exocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007610 and behavior and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008360 and regulation of cell shape and biological process this GO :0009636 and response to toxic substance and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010818 and T cell chemotaxis and biological process this GO :0014808 and release of sequestered calcium ion into cytosol by sarcoplasmic reticulum and biological process this GO :0016004 and phospholipase activator activity and molecular function this GO :0016301 and kinase activity and molecular function this GO :0019722 and calcium-mediated signaling and biological process this GO :0023052 and signaling and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0031726 and CCR1 chemokine receptor binding and molecular function this GO :0031730 and CCR5 chemokine receptor binding and molecular function this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043308 and eosinophil degranulation and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0043615 and astrocyte cell migration and biological process this GO :0043922 and negative regulation by host of viral transcription and biological process this GO :0045671 and negative regulation of osteoclast differentiation and biological process this GO :0048245 and eosinophil chemotaxis and biological process this GO :0048246 and macrophage chemotaxis and biological process this GO :0048247 and lymphocyte chemotaxis and biological process this GO :0050718 and positive regulation of interleukin-1 beta secretion and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050850 and positive regulation of calcium-mediated signaling and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0051928 and positive regulation of calcium ion transport and biological process this GO :0051930 and regulation of sensory perception of pain and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070723 and response to cholesterol and biological process this GO :0071346 and cellular response to interferon-gamma and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071621 and granulocyte chemotaxis and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :2000503 and positive regulation of natural killer cell chemotaxis and biological process, this GO :0004672: protein kinase activity, this GO :0004672: protein kinase activity and also this GO :0004698: calcium-dependent protein kinase C activity and also this GO :0005515: protein binding and also this GO :0008009: chemokine activity and also this GO :0016004: phospholipase activator activity and also this GO :0016301: kinase activity and also this GO :0031726: CCR1 chemokine receptor binding and also this GO :0031730: CCR5 chemokine receptor binding and also this GO :0042056: chemoattractant activity and also this GO :0042802: identical protein binding, this GO :0004698: calcium-dependent protein kinase C activity, this GO :0005515: protein binding, this GO :0008009: chemokine activity, this GO :0016004: phospholipase activator activity, this GO :0016301: kinase activity, this GO :0031726: CCR1 chemokine receptor binding, this GO :0031730: CCR5 chemokine receptor binding, this GO :0042056: chemoattractant activity, this GO :0042802: identical protein binding, chemokine (C-C motif) ligand 3 |
| Identity | 10627 |
| Gene | CCL3 |
| Long gene name | C-C motif chemokine ligand 3 |
| Synonyms gene | SCYA3 |
| Synonyms gene name | small inducible cytokine A3 (homologous to mouse Mip-1a) chemokine (C-C motif) ligand 3 |
| Synonyms | G0S19-1 LD78ALPHA MIP-1-alpha |
| Locus | 17q12 |
| Discovery year | 1990-07-05 |
| GenBank acession | M23178 |
| Entrez gene record | 6348 |
| RefSeq identity | NM_002983 |
| Classification | Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000188413 |