| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 11, 5 kD |
| UniProt number | O00175 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTCVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CCL24, Eotaxin-2, MPIF-2 (C-6His), C-C Motif Chemokine 24 |
| Short name | CCL24, Eotaxin-2, MPIF-2 (C-6His), Recombinant C-C Motif Chemokine 24 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | Eotaxin-2, MPIF-2 (C-6His), chemokine (C-C motif) ligand 24, sapiens C-C Motif Chemokine 24, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BT, CCL24 and IDBG-22726 and ENSG00000106178 and 6369, Ccl24 and IDBG-203945 and ENSMUSG00000004814 and 56221, Ckb-6 and MPIF-2 and MPIF2 and SCYA24, Extracellular, chemokine activity, this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008360 and regulation of cell shape and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030838 and positive regulation of actin filament polymerization and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0048245 and eosinophil chemotaxis and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :2000418 and positive regulation of eosinophil migration and biological process, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity and also this GO :0008009: chemokine activity, this GO :0008009: chemokine activity, 32408 and IDBG-640099 and ENSBTAG00000026275 and 617258, chemokine (C-C motif) ligand 24 |
| Identity | 10623 |
| Gene | CCL24 |
| Long gene name | C-C motif chemokine ligand 24 |
| Synonyms gene | SCYA24 |
| Synonyms gene name | member 24 chemokine (C-C motif) ligand 24 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms | Ckb-6 MPIF-2 eotaxin-2 MPIF2 |
| Synonyms name | CK-beta-6 myeloid progenitor inhibitory factor 2 eotaxin-2 |
| Locus | 7q11, 23 |
| Discovery year | 1997-11-14 |
| GenBank acession | U85768 |
| Entrez gene record | 6369 |
| Pubmed identfication | 9104803 9598329 |
| RefSeq identity | NM_002991 |
| Classification | Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000156635 |