| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 1 kD, 10 |
| UniProt number | Q9Y4X3 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 500 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 5, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CCL27, C-C Motif Chemokine 27 |
| Short name | CCL27, Recombinant C-C Motif Chemokine 27 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | chemokine (C-C motif) ligand 27, sapiens C-C Motif Chemokine 27, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | ALP and CTACK and CTAK and ESKINE and ILC and PESKY and SCYA27, CCL27 and IDBG-236604 and ENSG00000213927 and 10850, CCL27 and IDBG-635969 and ENSBTAG00000014908 and 101902682, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0060326 and cell chemotaxis and biological process, this GO :0008009: chemokine activity, this GO :0008009: chemokine activity, chemokine (C-C motif) ligand 27 |
| Identity | 10626 |
| Gene | CCL27 |
| Long gene name | C-C motif chemokine ligand 27 |
| Synonyms gene | SCYA27 |
| Synonyms gene name | member 27 chemokine (C-C motif) ligand 27 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms | ALP ILC CTACK skinkine ESkine PESKY CTAK |
| Synonyms name | CC chemokine ILC IL-11 Ralpha-locus chemokine cutaneous T-cell attracting chemokine |
| Locus | 9p13, 3 |
| Discovery year | 1999-07-30 |
| GenBank acession | AJ243542 |
| Entrez gene record | 10850 |
| Pubmed identfication | 10556532 10588729 |
| RefSeq identity | NM_006664 |
| Classification | Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000019834 |