| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 1 kD, 10 |
| UniProt number | P55774 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride,pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MGSSHHHHHHSSGLVPRGSHMAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CCL18, PARC (N-6His), C-C Motif Chemokine 18 |
| Short name | CCL18, PARC (N-6His), Recombinant C-C Motif Chemokine 18 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CCL18, PARC (N-6His), sapiens C-C Motif Chemokine 18, recombinant H |
| Alternative technique | rec |
| Identity | 10616 |
| Gene | CCL18 |
| Long gene name | C-C motif chemokine ligand 18 |
| Synonyms gene | SCYA18 |
| Synonyms gene name | member 18, pulmonary and activation-regulated chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) chemokine (C-C motif) ligand 18 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms | DC-CK1 PARC AMAC-1 DCCK1 MIP-4 CKb7 |
| Synonyms name | pulmonary and activation-regulated |
| Locus | 17q12 |
| Discovery year | 1997-01-08 |
| GenBank acession | Y13710 |
| Entrez gene record | 6362 |
| Pubmed identfication | 9233607 10049593 |
| RefSeq identity | NM_002988 |
| Classification | Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000188410 |