| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 9, 95 kD |
| UniProt number | P80075 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 1 mM EDTA, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKPVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CCL8, MCP-2 (C-6His), C-C Motif Chemokine 8 |
| Short name | CCL8, MCP-2 (C-6His), Recombinant C-C Motif Chemokine 8 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | MCP-2 (C-6His), chemokine (C-C motif) ligand 8, sapiens C-C Motif Chemokine 8, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CCL8 and IDBG-40686 and ENSG00000108700 and 6355, CCL8 and IDBG-630945 and ENSBTAG00000014113 and 281044, Extracellular, HC14 and MCP-2 and MCP2 and SCYA10 and SCYA8, phospholipase activator activity, this GO :0004672 and protein kinase activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006887 and exocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0009615 and response to virus and biological process this GO :0016004 and phospholipase activator activity and molecular function this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0004672: protein kinase activity, this GO :0004672: protein kinase activity and also this GO :0008009: chemokine activity and also this GO :0008201: heparin binding and also this GO :0016004: phospholipase activator activity, this GO :0008009: chemokine activity, this GO :0008201: heparin binding, this GO :0016004: phospholipase activator activity, 788169, chemokine (C-C motif) ligand 8 |
| Identity | 10635 |
| Gene | CCL8 |
| Long gene name | C-C motif chemokine ligand 8 |
| Synonyms gene | SCYA8 |
| Synonyms gene name | member 8 (monocyte chemotactic protein 2) chemokine (C-C motif) ligand 8 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms | MCP-2 HC14 |
| Locus | 17q12 |
| Discovery year | 1996-11-14 |
| GenBank acession | X99886 |
| Entrez gene record | 6355 |
| Pubmed identfication | 9119400 |
| RefSeq identity | NM_005623 |
| Classification | Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000132883 |