| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate |
| Molecular Weight | 37, 96 kD |
| UniProt number | Q8N2K1 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 1 mM DTT, 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | UBE2J2 (N-GST), Ubiquitin-Conjugating E2 J2 |
| Short name | UBE2J2 (N-GST), Recombinant Ubiquitin-Conjugating Enzyme E2 J2 |
| Technique | E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | UBE2J2 (N-GST), sapiens Ubiquitin-Conjugating Enzyme E2 J2, recombinant H |
| Alternative technique | rec |
| Identity | 19268 |
| Gene | UBE2J2 |
| Long gene name | ubiquitin conjugating enzyme E2 J2 |
| Synonyms gene name | J2 , J2 (UBC6 homolog, ubiquitin-conjugating enzyme E2, yeast) ubiquitin-conjugating enzyme E2 |
| Synonyms | Ubc6p NCUBE2 |
| Locus | 1p36, 33 |
| Discovery year | 2002-11-26 |
| GenBank acession | AF296658 |
| Entrez gene record | 118424 |
| Pubmed identfication | 11278356 |
| RefSeq identity | NM_058167 |
| Classification | Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT | OTTHUMG00000001911 |