| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate |
| Molecular Weight | 13 kD, 50 |
| UniProt number | Q16763 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 10% Glycerol, 150 mM sodium chloride, 2 mM DTT, pH 7, 2 um filtered solution of 50 mM HEPES, 5, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | UBE2S (N-GST), Ubiquitin-Conjugating E2 S |
| Short name | UBE2S (N-GST), Recombinant Ubiquitin-Conjugating Enzyme E2 S |
| Technique | E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | UBE2S (N-GST), sapiens Ubiquitin-Conjugating Enzyme E2 S, recombinant H |
| Alternative technique | rec |
| Identity | 17895 |
| Gene | UBE2S |
| Long gene name | ubiquitin conjugating enzyme E2 S |
| Synonyms gene name | ubiquitin-conjugating enzyme E2S |
| Synonyms | E2-EPF |
| Synonyms name | ubiquitin carrier protein ubiquitin-conjugating enzyme E2-24 kD ubiquitin-protein ligase |
| Locus | 19q13, 43 |
| Discovery year | 2004-01-12 |
| GenBank acession | BC004236 |
| Entrez gene record | 27338 |
| Pubmed identfication | 1379239 |
| RefSeq identity | NM_014501 |
| Classification | Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT | OTTHUMG00000180811 |